SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 479434.Sthe_1667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479434.Sthe_1667
Domain Number 1 Region: 140-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.4e-123
Family Enolase 0.0000000213
Further Details:      
 
Domain Number 2 Region: 5-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.19e-55
Family Enolase N-terminal domain-like 0.0000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479434.Sthe_1667
Sequence length 433
Comment (Sphaerobacter thermophilus DSM 20745)
Sequence
MVSTTIEAIKAREILDSRGNPTVEVDVILAGGARGRAAVPSGASTGAYEAVELRDKDQRY
GGKGVRTAVDNVNGPIAGVLLGMDAQDQRAIDMAMIELDGTPNKSRLGANAILGVSLATA
RAAAAAAGLPLYQYLGGPSAHVLPVPMMNILNGGKHAEGSTVDMQEFMVMPVGAPTFREG
LRWGAEIFHSLKKVLSSAGYATGVGDEGGYAPSLKSNQEALAYITQAIEQAGYRPGEDVL
LALDPASTELYEDGRYVLRGEGRTLTTAEMVDFWAEWVDRYPIISIEDGLAEDDWDGWAE
LTRRLGDRVQLVGDDLFVTNTQRLARGIELGVGNSILVKLNQIGTLSETFDAIAMAHRAG
FTAVISHRSGETADSFVADLAVATNAGQIKTGAPSRMDRVEKYNQLLRIEEELGTQAEYA
GRRAFAGLKGRSL
Download sequence
Identical sequences D1C4D4
gi|269837695|ref|YP_003319923.1| WP_012872148.1.32378 479434.Sthe_1667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]