SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 479434.Sthe_1855 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479434.Sthe_1855
Domain Number 1 Region: 19-204
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.73e-27
Family Clp protease, ClpP subunit 0.051
Further Details:      
 
Domain Number 2 Region: 378-443
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000405
Family NfeD domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479434.Sthe_1855
Sequence length 456
Comment (Sphaerobacter thermophilus DSM 20745)
Sequence
MTYPQPRIPTHRLTILITAVLLALASMIAPGVQAATPSVMLLDIDGAITPVVANYVERGL
RDAERVGASAVVLRMNTPGGLSSAMNDITTDIFASPVPVIVYVAPSGARAGSAGVYITYA
AHVAAMAPSTNIGSATPVFLDDSGQPQDADDAMTQKVVNDAVAQIRGFAEARGRNADWAE
QAVREAANITAQQALELNVIDLIAPDLPTLLDQVDGRTVETAAGPVTLQTRGAEIRTEGM
GLGEQFFQLISDPSIAYILLSLGMLGIFLELANPGSILPGVLGGIFVLLALFSLGSLDVN
WAGVLLMGFGFLLFVADVYVTSHGVLTIGGIAAFALGSIMLMNSTTVPAMQISKLVVAVV
TILVAGFFMFIVGAVAKARLRRASTGREGLIGAIGTVRQPLAPEGYVFVEGELWRATSPA
GPLEPGTSVRVIAVNGLTLTVMPAESEQALAAGQGA
Download sequence
Identical sequences D1C4X1
gi|269837882|ref|YP_003320110.1| 479434.Sthe_1855 WP_012872334.1.32378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]