SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 479437.Elen_1715 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  479437.Elen_1715
Domain Number - Region: 73-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0034
Family NfeD domain-like 0.0092
Further Details:      
 
Domain Number - Region: 12-75
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0101
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 479437.Elen_1715
Sequence length 142
Comment (Eggerthella lenta DSM 2243)
Sequence
MSPFIWLAVAAVMAVVEVVSFGLITMWFVIGALAAFAANLLGADLLVQIVVFLVVSVVCL
VALRPVFVKYRDRGKQEEPTHVGQTAVVVEDVDNEGLTGRVETDNRMTWAARSADGSFIP
QGAVVRIVGQESVKLIVERKVS
Download sequence
Identical sequences A0A096KMB8 C8WHT9 T4BEU3
WP_015760740.1.14381 WP_015760740.1.87427 WP_015760740.1.89587 gi|257791463|ref|YP_003182069.1| 479437.Elen_1715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]