SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 480224.Chy400_1932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  480224.Chy400_1932
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily GlnB-like 2.28e-22
Family Prokaryotic signal transducing protein 0.0000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 480224.Chy400_1932
Sequence length 105
Comment (Chloroflexus Y 400 fl)
Sequence
MELTTVKLVTIIAEAVLEDRLLHDLRHLGARGYTVGTVRGEGTRGIHASEWEGKSLRIET
LVNAEVAEKILQHLATAYFPHFAVIAYAMDVQVVRGAKFKGGGGR
Download sequence
Identical sequences A9WD35
324602.Caur_1785 480224.Chy400_1932 gi|163847347|ref|YP_001635391.1| WP_012257656.1.35445 YP_001635391.1.55443 gi|222525192|ref|YP_002569663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]