SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 481448.Minf_0091 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  481448.Minf_0091
Domain Number 1 Region: 87-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000379
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 481448.Minf_0091
Sequence length 156
Comment (Methylacidiphilum infernorum V4)
Sequence
MKTLLCILIFSGSSVLFIELLFPSYIMAFLGSLLLVGALALGFIFYGPGGAVVVIGAELL
VLLVALGIGIKIFPRTRLKKKMQLEETNREQTAFDINRLVGKEGRCESPCKPEGFVRVMS
KRLEAVSETGYIEEGLRIKVVGTKEGKAIVRAIRNG
Download sequence
Identical sequences B3DX11
gi|189218108|ref|YP_001938750.1| WP_012462433.1.19839 481448.Minf_0091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]