SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 481743.GYMC10_0202 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  481743.GYMC10_0202
Domain Number 1 Region: 138-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.53e-132
Family Enolase 0.00000000509
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.21e-60
Family Enolase N-terminal domain-like 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 481743.GYMC10_0202
Sequence length 429
Comment (Geobacillus Y412MC10)
Sequence
MTIISDVYAREVLDSRGNPTVEVEVYLESGAIGRAIVPSGASTGVHEAVELRDDDKSRYL
GKGVLKAVENVNEIIAPEVIGMDALDQLGIDKLMIALDGTPNKGKLGANAILAVSMAVAR
AAADALDLPLYVYLGGFNAKQLPVPMMNIVNGGAHADNNVDVQEFMVLPVGAPSFKEALR
MGAEIFHNLKSVLKGKGLNTAVGDEGGFAPNFTSNEDALSSIIEAIEKAGYKPGEDVLLG
MDVASTEFFKDGKYVLEGEGKSFTPAEFVDLLASWVDKYPIVTIEDGCSEDDWEGWKLLT
EKLGNKIQLVGDDLFVTNTERLEKGINEGIGNSILIKVNQIGTLTETFDAIEMAKRAGYT
AVISHRSGESEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLGELAQYNGL
KSFYNLKQK
Download sequence
Identical sequences A0A1H7RBN1 A0A2A5LAX8 D3E8D8 F3MDN8
gi|261404076|ref|YP_003240317.1| WP_009593642.1.24093 WP_009593642.1.35877 WP_009593642.1.3965 WP_009593642.1.52352 481743.GYMC10_0202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]