SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 481743.GYMC10_0551 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  481743.GYMC10_0551
Domain Number 1 Region: 35-152
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0000000000000955
Family Regulatory protein AraC 0.01
Further Details:      
 
Domain Number 2 Region: 236-287
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000121
Family AraC type transcriptional activator 0.035
Further Details:      
 
Domain Number 3 Region: 186-234
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000672
Family AraC type transcriptional activator 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 481743.GYMC10_0551
Sequence length 289
Comment (Geobacillus Y412MC10)
Sequence
MTILNFTVPPLPEYINSGLTRAPIHSGHPNRKNIGIFDLLVVRKGQLYVTENGSPYEIKP
GMFLILRPDTHHFGTRGCTEETDYYWLHFQTSGDWHPDEACQAPRREEVPELKAMTPNYF
SVNIPQFGTLPQPEKAMELLATLSSLVQYGHQAKILWRQQVVFQELIELLAAALDTPLSS
PSSACAERAAAYLRKHYREEFKVQELGDRINFHPVYIARCMQKEFGCSPVEYLQRYRIEQ
AKMLLMQTDFSISRVAEEVGFNHAAYFTSCFTKQEGISPRKYRQRFFMN
Download sequence
Identical sequences D3EBP1
481743.GYMC10_0551 gi|261404420|ref|YP_003240661.1| WP_012818752.1.35877 WP_012818752.1.52352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]