SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 481743.GYMC10_1757 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  481743.GYMC10_1757
Domain Number 1 Region: 20-215
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.2e-24
Family Biotin dependent carboxylase carboxyltransferase domain 0.076
Further Details:      
 
Weak hits

Sequence:  481743.GYMC10_1757
Domain Number - Region: 389-450
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00876
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 481743.GYMC10_1757
Sequence length 453
Comment (Geobacillus Y412MC10)
Sequence
MSRKLWMRRFLTLTAAVVMMLISIGMYAAPMKSAMAANIGSVYVIPVKQPIERGLTSFME
RGFKEAKEMAAGLIVLEIDTPGGLVDQAGEIATLMKGSEIPIVAYITGDAASAGSYIALN
ADKIAMSEGSMIGAAYMVDARGNRIEDAKLVSWWKSKMAGAAEAGGRNKEIAMGMADINL
KVDMPEIGLTKQPGEGLSLTHDEALKTGYADTIANSTEEVITWMDYSTQDVFRMEPTFSE
KLATFLTHPGVMTLLLFIGIAGVIIEVIVPGFGVPGILGVVAFVLYFFGNQVAGFAGWET
WLLFVIGIVMLAMELFVPSFGILGIIGSASLIAGVVMAAYSTSHVALSLGVAAASALVAI
IVVALVFKERGVWRKFILSDSLSKEQGYIPNEDRDVLIGLVGTSITPLRPAGTMELEGRR
LDVVTLGGFIDSGRPVRVIKTDGTRIVVEEEKG
Download sequence
Identical sequences D3E513
gi|261405606|ref|YP_003241847.1| 481743.GYMC10_1757 WP_015734195.1.35877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]