SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 481743.GYMC10_3367 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  481743.GYMC10_3367
Domain Number 1 Region: 102-373
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.83e-41
Family D-glucarate dehydratase-like 0.0012
Further Details:      
 
Domain Number 2 Region: 38-113
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.0000437
Family Enolase N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 481743.GYMC10_3367
Sequence length 382
Comment (Geobacillus Y412MC10)
Sequence
MNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSI
HMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLET
GASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWE
GTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEAL
YEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLD
AHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPAT
PGFGIVFDDELVTYLINRSGWS
Download sequence
Identical sequences D3EID5
WP_015735594.1.35877 WP_015735594.1.52352 gi|261407175|ref|YP_003243416.1| NYSGXRC-9825a 481743.GYMC10_3367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]