SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 481743.GYMC10_6063 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  481743.GYMC10_6063
Domain Number 1 Region: 14-156
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.00000000000000183
Family Regulatory protein AraC 0.013
Further Details:      
 
Domain Number 2 Region: 222-272
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000986
Family AraC type transcriptional activator 0.042
Further Details:      
 
Domain Number 3 Region: 173-220
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000301
Family AraC type transcriptional activator 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 481743.GYMC10_6063
Sequence length 274
Comment (Geobacillus Y412MC10)
Sequence
MSEQSVLSFTSLPLPYFLESGKTHYMPGESHPNRRNLGVFDLILVQRGCLFLGEENLQWA
LRAGDMAVLMPDAHHYAVQECREETSFYWLHFQSAATSTTDHASISHNIKLPRQGHIPYP
EQAYQLFDSLHLQATEPRSTAFWREQTLFIELLELLDPSRSDQEQSRVRKVAEQVESYIK
MHYREPISNARLSSDLHFHYNYLTRCMKASHGLTPTEYLLQYRLDQAKRLLLTTQWSMAR
IAEHVGFQYPPYFSRRFSARFGLSPLQFRKQYTE
Download sequence
Identical sequences A0A2A5LG44 D3EGB8
WP_015737880.1.35877 WP_015737880.1.52352 481743.GYMC10_6063 gi|261409834|ref|YP_003246075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]