SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 481805.EcolC_1387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  481805.EcolC_1387
Domain Number 1 Region: 109-298
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.21e-53
Family D-glucarate dehydratase-like 0.0000000488
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.06e-29
Family Enolase N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 481805.EcolC_1387
Sequence length 320
Comment (Escherichia coli C ATCC 8739)
Sequence
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQETWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSTLPVVEVDALERLL
Download sequence
Identical sequences A0A061KRY7 A0A069XSW9 A0A070STB8 A0A070V869 A0A090NXJ0 A0A0A6ZVI3 A0A0E0U1X8 A0A0E1M412 A0A0M7NVL9 A0A125X1E2 A0A140NA18 A0A142H4S1 A0A1X3JEV1 A0A236MUM0 B1IXS5 B1X8X5 C4ZUA4 F4SGJ2 F4TGU9 G0FDH4 H4ULP0 I2XIC0 M9GES2 P29208 Q32DS7 U9YAM0
gi|251785623|ref|YP_002999927.1| gi|253772814|ref|YP_003035645.1| gi|471333968|ref|YP_007557445.1| gi|251785623|ref|YP_002999927.1| gi|82777670|ref|YP_404019.1| 1fhuA gi|254162273|ref|YP_003045381.1| 1fhu_A gi|170019424|ref|YP_001724378.1| NP_416764.1.90541 WP_001255628.1.100085 WP_001255628.1.100111 WP_001255628.1.10034 WP_001255628.1.100441 WP_001255628.1.100451 WP_001255628.1.100496 WP_001255628.1.10051 WP_001255628.1.100614 WP_001255628.1.100824 WP_001255628.1.10086 WP_001255628.1.100868 WP_001255628.1.101033 WP_001255628.1.101158 WP_001255628.1.101186 WP_001255628.1.101282 WP_001255628.1.101423 WP_001255628.1.101654 WP_001255628.1.101737 WP_001255628.1.101747 WP_001255628.1.101777 WP_001255628.1.10188 WP_001255628.1.10235 WP_001255628.1.10252 WP_001255628.1.10304 WP_001255628.1.10417 WP_001255628.1.10491 WP_001255628.1.10496 WP_001255628.1.10569 WP_001255628.1.1058 WP_001255628.1.10729 WP_001255628.1.10833 WP_001255628.1.11047 WP_001255628.1.1113 WP_001255628.1.11955 WP_001255628.1.11982 WP_001255628.1.12060 WP_001255628.1.1212 WP_001255628.1.12415 WP_001255628.1.12468 WP_001255628.1.12542 WP_001255628.1.12558 WP_001255628.1.12582 WP_001255628.1.12594 WP_001255628.1.12675 WP_001255628.1.127 WP_001255628.1.12756 WP_001255628.1.12914 WP_001255628.1.13002 WP_001255628.1.13031 WP_001255628.1.13136 WP_001255628.1.13176 WP_001255628.1.13239 WP_001255628.1.13281 WP_001255628.1.13290 WP_001255628.1.13333 WP_001255628.1.1345 WP_001255628.1.13585 WP_001255628.1.13608 WP_001255628.1.13618 WP_001255628.1.13949 WP_001255628.1.14277 WP_001255628.1.14292 WP_001255628.1.14346 WP_001255628.1.14468 WP_001255628.1.14529 WP_001255628.1.1461 WP_001255628.1.14811 WP_001255628.1.14833 WP_001255628.1.14871 WP_001255628.1.14992 WP_001255628.1.1512 WP_001255628.1.15121 WP_001255628.1.15177 WP_001255628.1.15259 WP_001255628.1.153 WP_001255628.1.15576 WP_001255628.1.15645 WP_001255628.1.15747 WP_001255628.1.16086 WP_001255628.1.1609 WP_001255628.1.16111 WP_001255628.1.16179 WP_001255628.1.16294 WP_001255628.1.16500 WP_001255628.1.16532 WP_001255628.1.16541 WP_001255628.1.1655 WP_001255628.1.16577 WP_001255628.1.16612 WP_001255628.1.16715 WP_001255628.1.16721 WP_001255628.1.16752 WP_001255628.1.17018 WP_001255628.1.17084 WP_001255628.1.17087 WP_001255628.1.17123 WP_001255628.1.17216 WP_001255628.1.17360 WP_001255628.1.17432 WP_001255628.1.1755 WP_001255628.1.17577 WP_001255628.1.17831 WP_001255628.1.17937 WP_001255628.1.18381 WP_001255628.1.18402 WP_001255628.1.18550 WP_001255628.1.18588 WP_001255628.1.19150 WP_001255628.1.19205 WP_001255628.1.19206 WP_001255628.1.19277 WP_001255628.1.193 WP_001255628.1.19313 WP_001255628.1.19644 WP_001255628.1.19661 WP_001255628.1.1982 WP_001255628.1.19889 WP_001255628.1.19940 WP_001255628.1.19957 WP_001255628.1.20164 WP_001255628.1.20170 WP_001255628.1.20308 WP_001255628.1.20515 WP_001255628.1.20536 WP_001255628.1.20737 WP_001255628.1.20982 WP_001255628.1.2100 WP_001255628.1.21017 WP_001255628.1.21020 WP_001255628.1.21033 WP_001255628.1.21057 WP_001255628.1.21122 WP_001255628.1.21470 WP_001255628.1.2156 WP_001255628.1.21573 WP_001255628.1.21733 WP_001255628.1.21756 WP_001255628.1.21758 WP_001255628.1.22060 WP_001255628.1.22113 WP_001255628.1.22314 WP_001255628.1.22363 WP_001255628.1.22450 WP_001255628.1.22632 WP_001255628.1.22669 WP_001255628.1.22690 WP_001255628.1.22783 WP_001255628.1.22830 WP_001255628.1.22878 WP_001255628.1.22885 WP_001255628.1.2300 WP_001255628.1.23044 WP_001255628.1.23090 WP_001255628.1.23511 WP_001255628.1.23945 WP_001255628.1.24089 WP_001255628.1.24124 WP_001255628.1.2428 WP_001255628.1.24316 WP_001255628.1.24583 WP_001255628.1.24616 WP_001255628.1.24634 WP_001255628.1.24876 WP_001255628.1.24899 WP_001255628.1.24960 WP_001255628.1.25042 WP_001255628.1.25085 WP_001255628.1.25126 WP_001255628.1.25141 WP_001255628.1.25203 WP_001255628.1.25312 WP_001255628.1.25324 WP_001255628.1.25525 WP_001255628.1.25713 WP_001255628.1.26048 WP_001255628.1.26480 WP_001255628.1.26588 WP_001255628.1.26609 WP_001255628.1.27134 WP_001255628.1.27214 WP_001255628.1.27560 WP_001255628.1.27611 WP_001255628.1.27879 WP_001255628.1.27923 WP_001255628.1.27971 WP_001255628.1.28271 WP_001255628.1.28509 WP_001255628.1.28662 WP_001255628.1.28697 WP_001255628.1.28711 WP_001255628.1.28760 WP_001255628.1.28994 WP_001255628.1.29016 WP_001255628.1.29061 WP_001255628.1.29128 WP_001255628.1.29221 WP_001255628.1.2942 WP_001255628.1.2995 WP_001255628.1.29967 WP_001255628.1.30004 WP_001255628.1.30231 WP_001255628.1.30497 WP_001255628.1.30639 WP_001255628.1.30749 WP_001255628.1.30783 WP_001255628.1.31000 WP_001255628.1.31211 WP_001255628.1.31379 WP_001255628.1.31506 WP_001255628.1.31614 WP_001255628.1.31681 WP_001255628.1.3169 WP_001255628.1.31839 WP_001255628.1.31978 WP_001255628.1.32093 WP_001255628.1.3212 WP_001255628.1.32121 WP_001255628.1.32127 WP_001255628.1.32143 WP_001255628.1.32479 WP_001255628.1.32509 WP_001255628.1.32601 WP_001255628.1.32815 WP_001255628.1.32903 WP_001255628.1.32984 WP_001255628.1.33238 WP_001255628.1.33244 WP_001255628.1.33325 WP_001255628.1.334 WP_001255628.1.33408 WP_001255628.1.33424 WP_001255628.1.33476 WP_001255628.1.33502 WP_001255628.1.33565 WP_001255628.1.33746 WP_001255628.1.33973 WP_001255628.1.33974 WP_001255628.1.3401 WP_001255628.1.34124 WP_001255628.1.34270 WP_001255628.1.34363 WP_001255628.1.34525 WP_001255628.1.34538 WP_001255628.1.347 WP_001255628.1.34982 WP_001255628.1.34990 WP_001255628.1.34993 WP_001255628.1.3515 WP_001255628.1.35180 WP_001255628.1.35204 WP_001255628.1.35211 WP_001255628.1.35349 WP_001255628.1.35360 WP_001255628.1.35704 WP_001255628.1.35724 WP_001255628.1.35740 WP_001255628.1.36164 WP_001255628.1.3620 WP_001255628.1.36334 WP_001255628.1.36386 WP_001255628.1.36739 WP_001255628.1.36746 WP_001255628.1.37057 WP_001255628.1.37122 WP_001255628.1.3723 WP_001255628.1.37233 WP_001255628.1.37261 WP_001255628.1.37433 WP_001255628.1.37445 WP_001255628.1.37485 WP_001255628.1.37576 WP_001255628.1.37588 WP_001255628.1.37897 WP_001255628.1.37964 WP_001255628.1.38105 WP_001255628.1.3811 WP_001255628.1.38155 WP_001255628.1.38182 WP_001255628.1.38211 WP_001255628.1.38323 WP_001255628.1.38371 WP_001255628.1.38533 WP_001255628.1.38636 WP_001255628.1.38956 WP_001255628.1.39164 WP_001255628.1.39167 WP_001255628.1.39356 WP_001255628.1.39365 WP_001255628.1.39367 WP_001255628.1.39541 WP_001255628.1.39594 WP_001255628.1.39829 WP_001255628.1.39870 WP_001255628.1.39938 WP_001255628.1.39961 WP_001255628.1.40013 WP_001255628.1.40218 WP_001255628.1.40317 WP_001255628.1.40389 WP_001255628.1.40499 WP_001255628.1.40524 WP_001255628.1.40548 WP_001255628.1.406 WP_001255628.1.40815 WP_001255628.1.40898 WP_001255628.1.40912 WP_001255628.1.40937 WP_001255628.1.40965 WP_001255628.1.41206 WP_001255628.1.4126 WP_001255628.1.41363 WP_001255628.1.41436 WP_001255628.1.41484 WP_001255628.1.41530 WP_001255628.1.41556 WP_001255628.1.41621 WP_001255628.1.41782 WP_001255628.1.41900 WP_001255628.1.41960 WP_001255628.1.42022 WP_001255628.1.42033 WP_001255628.1.42073 WP_001255628.1.42209 WP_001255628.1.42376 WP_001255628.1.4242 WP_001255628.1.42432 WP_001255628.1.42632 WP_001255628.1.42770 WP_001255628.1.4282 WP_001255628.1.42879 WP_001255628.1.42936 WP_001255628.1.42989 WP_001255628.1.4306 WP_001255628.1.43174 WP_001255628.1.43270 WP_001255628.1.43444 WP_001255628.1.43473 WP_001255628.1.43622 WP_001255628.1.43989 WP_001255628.1.44088 WP_001255628.1.44100 WP_001255628.1.44115 WP_001255628.1.44162 WP_001255628.1.44211 WP_001255628.1.44365 WP_001255628.1.44558 WP_001255628.1.44724 WP_001255628.1.44849 WP_001255628.1.44854 WP_001255628.1.44923 WP_001255628.1.44970 WP_001255628.1.45043 WP_001255628.1.45116 WP_001255628.1.4516 WP_001255628.1.45246 WP_001255628.1.45313 WP_001255628.1.45329 WP_001255628.1.45581 WP_001255628.1.45595 WP_001255628.1.4574 WP_001255628.1.45752 WP_001255628.1.4593 WP_001255628.1.45933 WP_001255628.1.45945 WP_001255628.1.46115 WP_001255628.1.46186 WP_001255628.1.46213 WP_001255628.1.46325 WP_001255628.1.46329 WP_001255628.1.46441 WP_001255628.1.4647 WP_001255628.1.46573 WP_001255628.1.46582 WP_001255628.1.4670 WP_001255628.1.46802 WP_001255628.1.46909 WP_001255628.1.47038 WP_001255628.1.47048 WP_001255628.1.47156 WP_001255628.1.47322 WP_001255628.1.47386 WP_001255628.1.47401 WP_001255628.1.47414 WP_001255628.1.47496 WP_001255628.1.47634 WP_001255628.1.4772 WP_001255628.1.47734 WP_001255628.1.47764 WP_001255628.1.47765 WP_001255628.1.47791 WP_001255628.1.48080 WP_001255628.1.48096 WP_001255628.1.48111 WP_001255628.1.48194 WP_001255628.1.48290 WP_001255628.1.48477 WP_001255628.1.486 WP_001255628.1.4871 WP_001255628.1.48847 WP_001255628.1.48860 WP_001255628.1.48953 WP_001255628.1.48974 WP_001255628.1.49009 WP_001255628.1.49363 WP_001255628.1.49531 WP_001255628.1.49537 WP_001255628.1.49661 WP_001255628.1.49733 WP_001255628.1.49740 WP_001255628.1.49883 WP_001255628.1.49900 WP_001255628.1.50006 WP_001255628.1.50008 WP_001255628.1.50078 WP_001255628.1.5017 WP_001255628.1.50266 WP_001255628.1.50304 WP_001255628.1.50452 WP_001255628.1.50564 WP_001255628.1.5067 WP_001255628.1.51042 WP_001255628.1.51172 WP_001255628.1.51380 WP_001255628.1.5146 WP_001255628.1.51495 WP_001255628.1.51548 WP_001255628.1.51552 WP_001255628.1.51587 WP_001255628.1.51607 WP_001255628.1.51784 WP_001255628.1.51968 WP_001255628.1.52020 WP_001255628.1.52076 WP_001255628.1.52127 WP_001255628.1.52186 WP_001255628.1.52211 WP_001255628.1.52214 WP_001255628.1.52243 WP_001255628.1.52305 WP_001255628.1.52421 WP_001255628.1.52492 WP_001255628.1.52558 WP_001255628.1.5265 WP_001255628.1.52774 WP_001255628.1.52780 WP_001255628.1.52853 WP_001255628.1.52895 WP_001255628.1.53012 WP_001255628.1.53020 WP_001255628.1.53327 WP_001255628.1.53377 WP_001255628.1.53428 WP_001255628.1.53545 WP_001255628.1.53594 WP_001255628.1.53645 WP_001255628.1.53769 WP_001255628.1.53884 WP_001255628.1.53931 WP_001255628.1.53972 WP_001255628.1.53994 WP_001255628.1.54263 WP_001255628.1.54329 WP_001255628.1.54463 WP_001255628.1.54476 WP_001255628.1.54507 WP_001255628.1.54602 WP_001255628.1.54605 WP_001255628.1.54617 WP_001255628.1.54620 WP_001255628.1.54625 WP_001255628.1.54981 WP_001255628.1.55003 WP_001255628.1.55005 WP_001255628.1.55112 WP_001255628.1.55123 WP_001255628.1.55203 WP_001255628.1.55359 WP_001255628.1.55374 WP_001255628.1.55425 WP_001255628.1.55529 WP_001255628.1.55551 WP_001255628.1.55556 WP_001255628.1.55571 WP_001255628.1.55629 WP_001255628.1.55720 WP_001255628.1.55791 WP_001255628.1.55825 WP_001255628.1.55868 WP_001255628.1.5614 WP_001255628.1.56164 WP_001255628.1.56197 WP_001255628.1.56285 WP_001255628.1.56786 WP_001255628.1.56846 WP_001255628.1.56980 WP_001255628.1.57181 WP_001255628.1.57386 WP_001255628.1.57410 WP_001255628.1.57414 WP_001255628.1.57432 WP_001255628.1.58060 WP_001255628.1.58232 WP_001255628.1.58384 WP_001255628.1.58401 WP_001255628.1.58429 WP_001255628.1.58440 WP_001255628.1.58837 WP_001255628.1.58867 WP_001255628.1.58951 WP_001255628.1.58958 WP_001255628.1.58976 WP_001255628.1.59024 WP_001255628.1.59035 WP_001255628.1.59047 WP_001255628.1.59306 WP_001255628.1.59407 WP_001255628.1.59553 WP_001255628.1.59590 WP_001255628.1.59615 WP_001255628.1.5965 WP_001255628.1.59912 WP_001255628.1.59998 WP_001255628.1.6002 WP_001255628.1.60031 WP_001255628.1.60505 WP_001255628.1.60550 WP_001255628.1.6061 WP_001255628.1.6066 WP_001255628.1.60717 WP_001255628.1.60895 WP_001255628.1.60901 WP_001255628.1.61005 WP_001255628.1.61096 WP_001255628.1.61102 WP_001255628.1.61181 WP_001255628.1.61183 WP_001255628.1.61241 WP_001255628.1.61517 WP_001255628.1.61779 WP_001255628.1.61858 WP_001255628.1.61949 WP_001255628.1.62612 WP_001255628.1.62735 WP_001255628.1.62750 WP_001255628.1.62812 WP_001255628.1.62840 WP_001255628.1.62989 WP_001255628.1.63167 WP_001255628.1.63453 WP_001255628.1.63478 WP_001255628.1.6348 WP_001255628.1.63721 WP_001255628.1.64040 WP_001255628.1.64080 WP_001255628.1.6416 WP_001255628.1.64285 WP_001255628.1.64448 WP_001255628.1.64749 WP_001255628.1.64789 WP_001255628.1.64912 WP_001255628.1.6499 WP_001255628.1.65040 WP_001255628.1.65271 WP_001255628.1.65353 WP_001255628.1.65364 WP_001255628.1.65961 WP_001255628.1.66104 WP_001255628.1.66127 WP_001255628.1.66280 WP_001255628.1.6635 WP_001255628.1.66387 WP_001255628.1.66389 WP_001255628.1.66395 WP_001255628.1.66501 WP_001255628.1.6654 WP_001255628.1.6665 WP_001255628.1.66700 WP_001255628.1.66933 WP_001255628.1.67022 WP_001255628.1.67137 WP_001255628.1.67200 WP_001255628.1.67210 WP_001255628.1.67293 WP_001255628.1.67415 WP_001255628.1.67468 WP_001255628.1.67538 WP_001255628.1.67553 WP_001255628.1.67660 WP_001255628.1.67732 WP_001255628.1.67786 WP_001255628.1.67853 WP_001255628.1.6803 WP_001255628.1.6814 WP_001255628.1.68170 WP_001255628.1.68215 WP_001255628.1.68283 WP_001255628.1.68341 WP_001255628.1.68697 WP_001255628.1.68711 WP_001255628.1.68797 WP_001255628.1.68865 WP_001255628.1.68989 WP_001255628.1.69127 WP_001255628.1.6916 WP_001255628.1.6923 WP_001255628.1.69261 WP_001255628.1.69303 WP_001255628.1.69305 WP_001255628.1.6945 WP_001255628.1.69473 WP_001255628.1.69646 WP_001255628.1.69655 WP_001255628.1.69803 WP_001255628.1.6993 WP_001255628.1.70407 WP_001255628.1.70794 WP_001255628.1.70880 WP_001255628.1.71024 WP_001255628.1.71159 WP_001255628.1.71199 WP_001255628.1.71272 WP_001255628.1.71285 WP_001255628.1.71323 WP_001255628.1.71397 WP_001255628.1.71403 WP_001255628.1.71409 WP_001255628.1.71522 WP_001255628.1.71632 WP_001255628.1.71690 WP_001255628.1.71783 WP_001255628.1.71837 WP_001255628.1.71938 WP_001255628.1.71944 WP_001255628.1.71975 WP_001255628.1.71993 WP_001255628.1.72033 WP_001255628.1.7210 WP_001255628.1.72157 WP_001255628.1.72279 WP_001255628.1.72337 WP_001255628.1.72397 WP_001255628.1.72431 WP_001255628.1.72485 WP_001255628.1.72537 WP_001255628.1.72544 WP_001255628.1.72606 WP_001255628.1.72747 WP_001255628.1.72860 WP_001255628.1.72910 WP_001255628.1.73085 WP_001255628.1.73129 WP_001255628.1.73217 WP_001255628.1.73295 WP_001255628.1.73385 WP_001255628.1.73565 WP_001255628.1.73604 WP_001255628.1.73717 WP_001255628.1.73835 WP_001255628.1.73843 WP_001255628.1.73859 WP_001255628.1.73942 WP_001255628.1.74123 WP_001255628.1.74309 WP_001255628.1.74365 WP_001255628.1.74528 WP_001255628.1.7461 WP_001255628.1.74625 WP_001255628.1.74691 WP_001255628.1.7475 WP_001255628.1.74998 WP_001255628.1.75145 WP_001255628.1.75149 WP_001255628.1.75243 WP_001255628.1.75491 WP_001255628.1.75515 WP_001255628.1.75537 WP_001255628.1.75612 WP_001255628.1.75644 WP_001255628.1.75679 WP_001255628.1.75687 WP_001255628.1.75735 WP_001255628.1.75995 WP_001255628.1.76196 WP_001255628.1.76312 WP_001255628.1.76361 WP_001255628.1.76446 WP_001255628.1.76462 WP_001255628.1.76701 WP_001255628.1.76815 WP_001255628.1.76909 WP_001255628.1.76948 WP_001255628.1.77214 WP_001255628.1.77291 WP_001255628.1.77326 WP_001255628.1.77358 WP_001255628.1.77595 WP_001255628.1.77636 WP_001255628.1.77648 WP_001255628.1.77768 WP_001255628.1.77876 WP_001255628.1.78000 WP_001255628.1.78089 WP_001255628.1.78196 WP_001255628.1.78321 WP_001255628.1.7847 WP_001255628.1.78583 WP_001255628.1.78612 WP_001255628.1.78615 WP_001255628.1.78750 WP_001255628.1.78791 WP_001255628.1.78953 WP_001255628.1.7896 WP_001255628.1.79004 WP_001255628.1.79086 WP_001255628.1.79306 WP_001255628.1.79312 WP_001255628.1.79558 WP_001255628.1.79840 WP_001255628.1.7985 WP_001255628.1.79984 WP_001255628.1.80050 WP_001255628.1.80060 WP_001255628.1.80136 WP_001255628.1.80255 WP_001255628.1.80320 WP_001255628.1.80428 WP_001255628.1.80440 WP_001255628.1.80444 WP_001255628.1.80517 WP_001255628.1.80524 WP_001255628.1.8057 WP_001255628.1.80626 WP_001255628.1.80662 WP_001255628.1.80666 WP_001255628.1.80805 WP_001255628.1.80884 WP_001255628.1.8090 WP_001255628.1.81034 WP_001255628.1.81286 WP_001255628.1.81313 WP_001255628.1.81576 WP_001255628.1.81577 WP_001255628.1.81618 WP_001255628.1.81715 WP_001255628.1.81832 WP_001255628.1.81935 WP_001255628.1.81939 WP_001255628.1.82316 WP_001255628.1.8235 WP_001255628.1.82536 WP_001255628.1.82700 WP_001255628.1.82715 WP_001255628.1.82754 WP_001255628.1.82853 WP_001255628.1.83020 WP_001255628.1.8308 WP_001255628.1.83097 WP_001255628.1.83224 WP_001255628.1.83415 WP_001255628.1.8345 WP_001255628.1.83537 WP_001255628.1.8411 WP_001255628.1.84210 WP_001255628.1.84298 WP_001255628.1.84331 WP_001255628.1.84405 WP_001255628.1.84410 WP_001255628.1.8444 WP_001255628.1.84534 WP_001255628.1.84740 WP_001255628.1.84875 WP_001255628.1.84877 WP_001255628.1.84948 WP_001255628.1.84972 WP_001255628.1.84989 WP_001255628.1.84994 WP_001255628.1.85002 WP_001255628.1.85216 WP_001255628.1.85247 WP_001255628.1.85255 WP_001255628.1.85260 WP_001255628.1.85310 WP_001255628.1.85500 WP_001255628.1.8560 WP_001255628.1.85752 WP_001255628.1.85948 WP_001255628.1.86016 WP_001255628.1.86161 WP_001255628.1.86189 WP_001255628.1.86412 WP_001255628.1.86461 WP_001255628.1.86475 WP_001255628.1.86609 WP_001255628.1.86691 WP_001255628.1.86760 WP_001255628.1.86787 WP_001255628.1.86997 WP_001255628.1.87389 WP_001255628.1.87655 WP_001255628.1.87914 WP_001255628.1.88017 WP_001255628.1.88301 WP_001255628.1.88434 WP_001255628.1.88607 WP_001255628.1.88711 WP_001255628.1.88757 WP_001255628.1.8879 WP_001255628.1.88834 WP_001255628.1.89099 WP_001255628.1.89416 WP_001255628.1.89458 WP_001255628.1.89468 WP_001255628.1.89471 WP_001255628.1.89674 WP_001255628.1.89679 WP_001255628.1.89899 WP_001255628.1.89927 WP_001255628.1.89977 WP_001255628.1.90017 WP_001255628.1.90078 WP_001255628.1.90358 WP_001255628.1.9036 WP_001255628.1.90449 WP_001255628.1.90511 WP_001255628.1.90536 WP_001255628.1.90828 WP_001255628.1.90951 WP_001255628.1.91277 WP_001255628.1.91340 WP_001255628.1.91341 WP_001255628.1.91462 WP_001255628.1.91551 WP_001255628.1.91640 WP_001255628.1.91850 WP_001255628.1.9215 WP_001255628.1.92180 WP_001255628.1.92361 WP_001255628.1.92496 WP_001255628.1.92568 WP_001255628.1.92614 WP_001255628.1.92615 WP_001255628.1.9264 WP_001255628.1.92708 WP_001255628.1.92742 WP_001255628.1.92792 WP_001255628.1.92845 WP_001255628.1.92943 WP_001255628.1.93019 WP_001255628.1.93048 WP_001255628.1.93054 WP_001255628.1.93175 WP_001255628.1.93276 WP_001255628.1.93629 WP_001255628.1.93634 WP_001255628.1.93652 WP_001255628.1.93673 WP_001255628.1.93755 WP_001255628.1.93911 WP_001255628.1.93971 WP_001255628.1.94057 WP_001255628.1.94176 WP_001255628.1.94187 WP_001255628.1.94271 WP_001255628.1.94388 WP_001255628.1.94542 WP_001255628.1.9457 WP_001255628.1.94692 WP_001255628.1.94738 WP_001255628.1.948 WP_001255628.1.9489 WP_001255628.1.94938 WP_001255628.1.94949 WP_001255628.1.95037 WP_001255628.1.95332 WP_001255628.1.95595 WP_001255628.1.95827 WP_001255628.1.95849 WP_001255628.1.95932 WP_001255628.1.96215 WP_001255628.1.96279 WP_001255628.1.96290 WP_001255628.1.96299 WP_001255628.1.96303 WP_001255628.1.96339 WP_001255628.1.96394 WP_001255628.1.96417 WP_001255628.1.97011 WP_001255628.1.97119 WP_001255628.1.97123 WP_001255628.1.97231 WP_001255628.1.97418 WP_001255628.1.97439 WP_001255628.1.9747 WP_001255628.1.97560 WP_001255628.1.97930 WP_001255628.1.97982 WP_001255628.1.97996 WP_001255628.1.98220 WP_001255628.1.98235 WP_001255628.1.98294 WP_001255628.1.98355 WP_001255628.1.98424 WP_001255628.1.98477 WP_001255628.1.98578 WP_001255628.1.98614 WP_001255628.1.98628 WP_001255628.1.9864 WP_001255628.1.98776 WP_001255628.1.99265 WP_001255628.1.99310 WP_001255628.1.99319 WP_001255628.1.99453 WP_001255628.1.99602 WP_001255628.1.99603 WP_001255628.1.99929 YP_404019.1.10455 300267.SDY_2457 316385.ECDH10B_2422 316407.menC 413997.ECB_02188 469008.ECBD_1397 481805.EcolC_1387 511145.b2261 595496.BWG_2035 gi|386614876|ref|YP_006134542.1| gi|387621972|ref|YP_006129599.1| gi|560158035|ref|YP_008850750.1| gi|388478309|ref|YP_490501.1| gi|238901436|ref|YP_002927232.1| gi|386705523|ref|YP_006169370.1| gi|16130196|ref|NP_416764.1| gi|387621972|ref|YP_006129599.1| gi|170081880|ref|YP_001731200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]