SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 481805.EcolC_2278 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  481805.EcolC_2278
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.14e-118
Family PFOR PP module 0.0000000338
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.54e-77
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000122
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.65e-72
Family PFOR Pyr module 0.000000093
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.57e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000207
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.7e-23
Family Ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 481805.EcolC_2278
Sequence length 1174
Comment (Escherichia coli C ATCC 8739)
Sequence
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAANVQEAQDFALISHIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILDLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
QAMNDFAAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEEVIDELLTRGENVGVLKVRL
YRPFSAKHLLQALPGSVRSVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTLPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVINAAKIARECGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPAELLTALKSDATPEVRREQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSEALEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
Download sequence
Identical sequences A0A2K3RND4
331112.EcHS_A1464 481805.EcolC_2278 gi|170020287|ref|YP_001725241.1| WP_000628174.1.100444 WP_000628174.1.100496 WP_000628174.1.10094 WP_000628174.1.10233 WP_000628174.1.11418 WP_000628174.1.13664 WP_000628174.1.13672 WP_000628174.1.13824 WP_000628174.1.13974 WP_000628174.1.14292 WP_000628174.1.1655 WP_000628174.1.17150 WP_000628174.1.17831 WP_000628174.1.19878 WP_000628174.1.20308 WP_000628174.1.20691 WP_000628174.1.2362 WP_000628174.1.24499 WP_000628174.1.27098 WP_000628174.1.27214 WP_000628174.1.31898 WP_000628174.1.3212 WP_000628174.1.33751 WP_000628174.1.342 WP_000628174.1.36531 WP_000628174.1.38211 WP_000628174.1.38363 WP_000628174.1.38544 WP_000628174.1.38843 WP_000628174.1.41826 WP_000628174.1.43444 WP_000628174.1.43989 WP_000628174.1.45116 WP_000628174.1.4670 WP_000628174.1.49236 WP_000628174.1.49883 WP_000628174.1.50717 WP_000628174.1.52135 WP_000628174.1.5272 WP_000628174.1.53244 WP_000628174.1.56436 WP_000628174.1.61183 WP_000628174.1.64353 WP_000628174.1.66127 WP_000628174.1.67021 WP_000628174.1.67660 WP_000628174.1.6993 WP_000628174.1.75209 WP_000628174.1.75672 WP_000628174.1.76211 WP_000628174.1.76547 WP_000628174.1.76562 WP_000628174.1.81127 WP_000628174.1.82536 WP_000628174.1.83097 WP_000628174.1.84467 WP_000628174.1.84972 WP_000628174.1.85323 WP_000628174.1.85773 WP_000628174.1.86189 WP_000628174.1.86228 WP_000628174.1.90703 WP_000628174.1.90865 WP_000628174.1.93309 WP_000628174.1.94542 WP_000628174.1.94692 WP_000628174.1.96290 WP_000628174.1.99400 WP_000628174.1.99929 gi|157160859|ref|YP_001458177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]