SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 483179.BCAN_A0242 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  483179.BCAN_A0242
Domain Number 1 Region: 115-358
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.32e-74
Family D-glucarate dehydratase-like 0.0000728
Further Details:      
 
Domain Number 2 Region: 3-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.09e-31
Family Enolase N-terminal domain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 483179.BCAN_A0242
Sequence length 372
Comment (Brucella canis ATCC 23365)
Sequence
MARIERFELRMVDLPPKAKRTDAIQSFVSQETPIVTITDSDGAVGTGYSYTIGTGGSSVM
RLLADHLAPLVIGEDADCIEAIWRRLEFATHATTIGAITALALAAIDTALWDLRAKKQNL
PLWKLAGGARDHCPLYTTEGGWLHIEKEALVEDALQAKAKGFTGSKIKIGKPHGAQDYAR
LSAVRAAVGAAFEIMTDCNQGFTVDEAIRRAERLKELDLAWIEEPLPADDLDGHMRLARS
TATPVAVGESIYSIRHFREYMHKGACSIVQVDVARIGGITPWLKVAHMAEAFDIPVCPHF
LMELHVSLVCAVPNGRYVEYIPQLDDLTDKGMEIRDSHAVAPSQPGIGIAWDWDAVRSRS
IGEFTREIVRAP
Download sequence
Identical sequences A0A0H3G5M9 A0A2D2BMA3 A9M7S6 B0CJ92
gi|163842502|ref|YP_001626906.1| gi|23501146|ref|NP_697273.1| gi|376274990|ref|YP_005115429.1| gi|23501146|ref|NP_697273.1| gi|161618220|ref|YP_001592107.1| gi|376279934|ref|YP_005153940.1| WP_004691448.1.100204 WP_004691448.1.10307 WP_004691448.1.1158 WP_004691448.1.11769 WP_004691448.1.13020 WP_004691448.1.13576 WP_004691448.1.13592 WP_004691448.1.15325 WP_004691448.1.17733 WP_004691448.1.1800 WP_004691448.1.19645 WP_004691448.1.2214 WP_004691448.1.22340 WP_004691448.1.23458 WP_004691448.1.24496 WP_004691448.1.2483 WP_004691448.1.27052 WP_004691448.1.31463 WP_004691448.1.3390 WP_004691448.1.34225 WP_004691448.1.38343 WP_004691448.1.38790 WP_004691448.1.408 WP_004691448.1.43006 WP_004691448.1.43689 WP_004691448.1.43928 WP_004691448.1.44294 WP_004691448.1.44949 WP_004691448.1.45546 WP_004691448.1.49427 WP_004691448.1.49542 WP_004691448.1.49753 WP_004691448.1.52027 WP_004691448.1.56313 WP_004691448.1.57564 WP_004691448.1.58260 WP_004691448.1.58868 WP_004691448.1.59091 WP_004691448.1.5971 WP_004691448.1.60631 WP_004691448.1.62592 WP_004691448.1.63732 WP_004691448.1.64849 WP_004691448.1.65299 WP_004691448.1.65651 WP_004691448.1.66340 WP_004691448.1.67402 WP_004691448.1.68488 WP_004691448.1.70570 WP_004691448.1.71002 WP_004691448.1.74005 WP_004691448.1.77165 WP_004691448.1.78716 WP_004691448.1.80365 WP_004691448.1.81027 WP_004691448.1.81558 WP_004691448.1.8223 WP_004691448.1.83161 WP_004691448.1.84512 WP_004691448.1.85721 WP_004691448.1.87893 WP_004691448.1.91958 WP_004691448.1.93367 WP_004691448.1.94770 WP_004691448.1.98362 WP_004691448.1.98704 204722.BR0239 470137.BSUIS_A0239 483179.BCAN_A0242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]