SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 484019.THA_1670 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  484019.THA_1670
Domain Number 1 Region: 43-111
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000102
Family NfeD domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 484019.THA_1670
Sequence length 114
Comment (Thermosipho africanus TCF52B)
Sequence
MASALVAFFVGNTIWELATFIVVSGILVILTRPLANKISGEQTRKINVDEIIGKHALVLE
DINNKAGTGIIKVNGDTWRAFSNDDEIVIKKGEYVKILQVEGAHVVVEKIDQGV
Download sequence
Identical sequences B7IDN1
484019.THA_1670 gi|217077731|ref|YP_002335449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]