SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 484019.THA_334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  484019.THA_334
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 484019.THA_334
Sequence length 179
Comment (Thermosipho africanus TCF52B)
Sequence
MRFVFAGFGGQGVMLMGQILAYAGMIEGKSVTWMPSYGPEMRGGTANCTVVVEDKEVASP
VVDKAEVVVAMNIPSMLKFQSFVTDGGYLFLNESVIDREPERKDGINIYKINCNEIADEL
GNLKVANMVMLGAVIGATNIVSKESVIKALEQKLTGKKADLIDINIKAIERGMQEANKQ
Download sequence
Identical sequences B7IFH0
484019.THA_334 WP_012579506.1.97851 gi|217076459|ref|YP_002334175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]