SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 484021.KP1_1345 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  484021.KP1_1345
Domain Number 1 Region: 107-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000641
Family NfeD domain-like 0.0054
Further Details:      
 
Weak hits

Sequence:  484021.KP1_1345
Domain Number - Region: 27-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00654
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 484021.KP1_1345
Sequence length 152
Comment (Klebsiella pneumoniae NTUH K2044)
Sequence
MIGMILAHPHLFWLSLGGLLLAAEMLGGSGYLLWSGVAGVVTGALTWLLPLSWEWQGTLF
AVLTLLAAWLWSKWLRKRVKTQRPADAQLNQRGQQLVGRRLTLDAPLVNGRGHVRVGDSS
WPVIADEDFAAGSKVEVIAVEGITLRIRPAVR
Download sequence
Identical sequences A0A1D3KFP4 A0A1Y0Q4A1 A0A2G8AT04 C8T2I9 V0AS09 W9BE24
484021.KP1_1345 gi|402782046|ref|YP_006637592.1| gi|238893454|ref|YP_002918188.1| gi|550443508|ref|YP_008659048.1| WP_004142979.1.100145 WP_004142979.1.100175 WP_004142979.1.100193 WP_004142979.1.100239 WP_004142979.1.100268 WP_004142979.1.100403 WP_004142979.1.100445 WP_004142979.1.100465 WP_004142979.1.100514 WP_004142979.1.100611 WP_004142979.1.100635 WP_004142979.1.10092 WP_004142979.1.100964 WP_004142979.1.10102 WP_004142979.1.101034 WP_004142979.1.101198 WP_004142979.1.101234 WP_004142979.1.101332 WP_004142979.1.10134 WP_004142979.1.101526 WP_004142979.1.101702 WP_004142979.1.101749 WP_004142979.1.10194 WP_004142979.1.101972 WP_004142979.1.102075 WP_004142979.1.102090 WP_004142979.1.10213 WP_004142979.1.102146 WP_004142979.1.10241 WP_004142979.1.10278 WP_004142979.1.10291 WP_004142979.1.10296 WP_004142979.1.10395 WP_004142979.1.10681 WP_004142979.1.10778 WP_004142979.1.11020 WP_004142979.1.11036 WP_004142979.1.11092 WP_004142979.1.11122 WP_004142979.1.11147 WP_004142979.1.11210 WP_004142979.1.11237 WP_004142979.1.11267 WP_004142979.1.11349 WP_004142979.1.11502 WP_004142979.1.11535 WP_004142979.1.11675 WP_004142979.1.11683 WP_004142979.1.11685 WP_004142979.1.11733 WP_004142979.1.11742 WP_004142979.1.11808 WP_004142979.1.11864 WP_004142979.1.11891 WP_004142979.1.11957 WP_004142979.1.12086 WP_004142979.1.12237 WP_004142979.1.12445 WP_004142979.1.12564 WP_004142979.1.12722 WP_004142979.1.12747 WP_004142979.1.12896 WP_004142979.1.12900 WP_004142979.1.12924 WP_004142979.1.12939 WP_004142979.1.12983 WP_004142979.1.13149 WP_004142979.1.1322 WP_004142979.1.13450 WP_004142979.1.13541 WP_004142979.1.13660 WP_004142979.1.13773 WP_004142979.1.14090 WP_004142979.1.14109 WP_004142979.1.14171 WP_004142979.1.14248 WP_004142979.1.14252 WP_004142979.1.14290 WP_004142979.1.14407 WP_004142979.1.1441 WP_004142979.1.14580 WP_004142979.1.14585 WP_004142979.1.1464 WP_004142979.1.14715 WP_004142979.1.1478 WP_004142979.1.14796 WP_004142979.1.14813 WP_004142979.1.14830 WP_004142979.1.1500 WP_004142979.1.15060 WP_004142979.1.1513 WP_004142979.1.15243 WP_004142979.1.15307 WP_004142979.1.15320 WP_004142979.1.15331 WP_004142979.1.15339 WP_004142979.1.15491 WP_004142979.1.15852 WP_004142979.1.15942 WP_004142979.1.15994 WP_004142979.1.160 WP_004142979.1.16054 WP_004142979.1.16289 WP_004142979.1.16299 WP_004142979.1.16314 WP_004142979.1.16326 WP_004142979.1.16380 WP_004142979.1.16542 WP_004142979.1.16559 WP_004142979.1.16659 WP_004142979.1.16738 WP_004142979.1.16877 WP_004142979.1.16917 WP_004142979.1.1702 WP_004142979.1.17326 WP_004142979.1.17556 WP_004142979.1.17661 WP_004142979.1.17846 WP_004142979.1.17921 WP_004142979.1.17930 WP_004142979.1.18096 WP_004142979.1.18171 WP_004142979.1.18176 WP_004142979.1.18241 WP_004142979.1.18378 WP_004142979.1.18409 WP_004142979.1.18515 WP_004142979.1.18599 WP_004142979.1.18682 WP_004142979.1.1869 WP_004142979.1.18695 WP_004142979.1.187 WP_004142979.1.19317 WP_004142979.1.1937 WP_004142979.1.19439 WP_004142979.1.19533 WP_004142979.1.1986 WP_004142979.1.19937 WP_004142979.1.19984 WP_004142979.1.20019 WP_004142979.1.20050 WP_004142979.1.20122 WP_004142979.1.20205 WP_004142979.1.2023 WP_004142979.1.20278 WP_004142979.1.2031 WP_004142979.1.2038 WP_004142979.1.20426 WP_004142979.1.20476 WP_004142979.1.20528 WP_004142979.1.20685 WP_004142979.1.20991 WP_004142979.1.21228 WP_004142979.1.2150 WP_004142979.1.21566 WP_004142979.1.21772 WP_004142979.1.21799 WP_004142979.1.21869 WP_004142979.1.2193 WP_004142979.1.21936 WP_004142979.1.21953 WP_004142979.1.21968 WP_004142979.1.22001 WP_004142979.1.22044 WP_004142979.1.22072 WP_004142979.1.22184 WP_004142979.1.22215 WP_004142979.1.22471 WP_004142979.1.22520 WP_004142979.1.22555 WP_004142979.1.2258 WP_004142979.1.22584 WP_004142979.1.22630 WP_004142979.1.22648 WP_004142979.1.2265 WP_004142979.1.22686 WP_004142979.1.22698 WP_004142979.1.2272 WP_004142979.1.22828 WP_004142979.1.22932 WP_004142979.1.22956 WP_004142979.1.23112 WP_004142979.1.23145 WP_004142979.1.23348 WP_004142979.1.2347 WP_004142979.1.23562 WP_004142979.1.23607 WP_004142979.1.23609 WP_004142979.1.2367 WP_004142979.1.23758 WP_004142979.1.24055 WP_004142979.1.24095 WP_004142979.1.24103 WP_004142979.1.24209 WP_004142979.1.24342 WP_004142979.1.24353 WP_004142979.1.24590 WP_004142979.1.24707 WP_004142979.1.24816 WP_004142979.1.24822 WP_004142979.1.25163 WP_004142979.1.25239 WP_004142979.1.25275 WP_004142979.1.25306 WP_004142979.1.2536 WP_004142979.1.25379 WP_004142979.1.25407 WP_004142979.1.25492 WP_004142979.1.25575 WP_004142979.1.25904 WP_004142979.1.25918 WP_004142979.1.25920 WP_004142979.1.25933 WP_004142979.1.25942 WP_004142979.1.26285 WP_004142979.1.26299 WP_004142979.1.26427 WP_004142979.1.26762 WP_004142979.1.2683 WP_004142979.1.26843 WP_004142979.1.2686 WP_004142979.1.26890 WP_004142979.1.26974 WP_004142979.1.27144 WP_004142979.1.2716 WP_004142979.1.27264 WP_004142979.1.27268 WP_004142979.1.27319 WP_004142979.1.27477 WP_004142979.1.27550 WP_004142979.1.27809 WP_004142979.1.27925 WP_004142979.1.28049 WP_004142979.1.28086 WP_004142979.1.28115 WP_004142979.1.2814 WP_004142979.1.28152 WP_004142979.1.28196 WP_004142979.1.28375 WP_004142979.1.28435 WP_004142979.1.28446 WP_004142979.1.28463 WP_004142979.1.28640 WP_004142979.1.28660 WP_004142979.1.28688 WP_004142979.1.28717 WP_004142979.1.28752 WP_004142979.1.28857 WP_004142979.1.28972 WP_004142979.1.28992 WP_004142979.1.29120 WP_004142979.1.29152 WP_004142979.1.29240 WP_004142979.1.29333 WP_004142979.1.29334 WP_004142979.1.29448 WP_004142979.1.29506 WP_004142979.1.29583 WP_004142979.1.29748 WP_004142979.1.29816 WP_004142979.1.29829 WP_004142979.1.29858 WP_004142979.1.29871 WP_004142979.1.29974 WP_004142979.1.2999 WP_004142979.1.30072 WP_004142979.1.30078 WP_004142979.1.30207 WP_004142979.1.30218 WP_004142979.1.30416 WP_004142979.1.30426 WP_004142979.1.30539 WP_004142979.1.3081 WP_004142979.1.31061 WP_004142979.1.31064 WP_004142979.1.3111 WP_004142979.1.31257 WP_004142979.1.3138 WP_004142979.1.31400 WP_004142979.1.3159 WP_004142979.1.31591 WP_004142979.1.31601 WP_004142979.1.31648 WP_004142979.1.31920 WP_004142979.1.32013 WP_004142979.1.32023 WP_004142979.1.32086 WP_004142979.1.32300 WP_004142979.1.32354 WP_004142979.1.32749 WP_004142979.1.32797 WP_004142979.1.3282 WP_004142979.1.32936 WP_004142979.1.33057 WP_004142979.1.33229 WP_004142979.1.33399 WP_004142979.1.33406 WP_004142979.1.33414 WP_004142979.1.33446 WP_004142979.1.33498 WP_004142979.1.3361 WP_004142979.1.33642 WP_004142979.1.33660 WP_004142979.1.33750 WP_004142979.1.33794 WP_004142979.1.33806 WP_004142979.1.33836 WP_004142979.1.33838 WP_004142979.1.33942 WP_004142979.1.33943 WP_004142979.1.33985 WP_004142979.1.34110 WP_004142979.1.34173 WP_004142979.1.34200 WP_004142979.1.34213 WP_004142979.1.34265 WP_004142979.1.34281 WP_004142979.1.34367 WP_004142979.1.3450 WP_004142979.1.34654 WP_004142979.1.34681 WP_004142979.1.34748 WP_004142979.1.34757 WP_004142979.1.34826 WP_004142979.1.34850 WP_004142979.1.34853 WP_004142979.1.34910 WP_004142979.1.35028 WP_004142979.1.35109 WP_004142979.1.35197 WP_004142979.1.35214 WP_004142979.1.3525 WP_004142979.1.35268 WP_004142979.1.35284 WP_004142979.1.35286 WP_004142979.1.3529 WP_004142979.1.35453 WP_004142979.1.35496 WP_004142979.1.35574 WP_004142979.1.35645 WP_004142979.1.35786 WP_004142979.1.35824 WP_004142979.1.35914 WP_004142979.1.35918 WP_004142979.1.36029 WP_004142979.1.36080 WP_004142979.1.36084 WP_004142979.1.36204 WP_004142979.1.36261 WP_004142979.1.3640 WP_004142979.1.36402 WP_004142979.1.36468 WP_004142979.1.36483 WP_004142979.1.3657 WP_004142979.1.36659 WP_004142979.1.36728 WP_004142979.1.36825 WP_004142979.1.36998 WP_004142979.1.37140 WP_004142979.1.37264 WP_004142979.1.37286 WP_004142979.1.37356 WP_004142979.1.3738 WP_004142979.1.37391 WP_004142979.1.37422 WP_004142979.1.37456 WP_004142979.1.37614 WP_004142979.1.37617 WP_004142979.1.37716 WP_004142979.1.37860 WP_004142979.1.38094 WP_004142979.1.38096 WP_004142979.1.38215 WP_004142979.1.38399 WP_004142979.1.38593 WP_004142979.1.38684 WP_004142979.1.38700 WP_004142979.1.38729 WP_004142979.1.38799 WP_004142979.1.388 WP_004142979.1.38815 WP_004142979.1.3888 WP_004142979.1.39299 WP_004142979.1.39360 WP_004142979.1.39391 WP_004142979.1.39456 WP_004142979.1.39532 WP_004142979.1.39534 WP_004142979.1.39705 WP_004142979.1.39852 WP_004142979.1.3988 WP_004142979.1.40042 WP_004142979.1.40054 WP_004142979.1.40145 WP_004142979.1.40295 WP_004142979.1.40396 WP_004142979.1.40551 WP_004142979.1.40587 WP_004142979.1.40597 WP_004142979.1.4064 WP_004142979.1.4069 WP_004142979.1.4072 WP_004142979.1.40798 WP_004142979.1.40817 WP_004142979.1.40825 WP_004142979.1.40878 WP_004142979.1.40913 WP_004142979.1.40967 WP_004142979.1.41095 WP_004142979.1.41096 WP_004142979.1.41159 WP_004142979.1.41303 WP_004142979.1.4131 WP_004142979.1.41352 WP_004142979.1.41405 WP_004142979.1.41563 WP_004142979.1.41644 WP_004142979.1.4167 WP_004142979.1.41713 WP_004142979.1.4177 WP_004142979.1.41794 WP_004142979.1.41895 WP_004142979.1.41907 WP_004142979.1.41992 WP_004142979.1.42054 WP_004142979.1.42139 WP_004142979.1.42153 WP_004142979.1.42264 WP_004142979.1.42299 WP_004142979.1.42476 WP_004142979.1.42635 WP_004142979.1.42755 WP_004142979.1.4286 WP_004142979.1.42881 WP_004142979.1.42929 WP_004142979.1.42953 WP_004142979.1.43043 WP_004142979.1.43050 WP_004142979.1.43084 WP_004142979.1.43146 WP_004142979.1.43228 WP_004142979.1.43413 WP_004142979.1.43445 WP_004142979.1.43468 WP_004142979.1.43836 WP_004142979.1.43853 WP_004142979.1.43867 WP_004142979.1.43874 WP_004142979.1.4393 WP_004142979.1.44117 WP_004142979.1.4414 WP_004142979.1.44158 WP_004142979.1.4416 WP_004142979.1.44235 WP_004142979.1.44267 WP_004142979.1.4430 WP_004142979.1.44528 WP_004142979.1.44708 WP_004142979.1.44931 WP_004142979.1.45137 WP_004142979.1.45327 WP_004142979.1.45395 WP_004142979.1.45607 WP_004142979.1.45821 WP_004142979.1.45911 WP_004142979.1.46134 WP_004142979.1.46199 WP_004142979.1.46221 WP_004142979.1.46254 WP_004142979.1.46327 WP_004142979.1.46384 WP_004142979.1.4641 WP_004142979.1.46561 WP_004142979.1.4664 WP_004142979.1.46838 WP_004142979.1.46971 WP_004142979.1.46985 WP_004142979.1.47104 WP_004142979.1.47199 WP_004142979.1.472 WP_004142979.1.47264 WP_004142979.1.47379 WP_004142979.1.47419 WP_004142979.1.47521 WP_004142979.1.4760 WP_004142979.1.47777 WP_004142979.1.47871 WP_004142979.1.47885 WP_004142979.1.47919 WP_004142979.1.48022 WP_004142979.1.48110 WP_004142979.1.48138 WP_004142979.1.48274 WP_004142979.1.48496 WP_004142979.1.48587 WP_004142979.1.48606 WP_004142979.1.48609 WP_004142979.1.48793 WP_004142979.1.48859 WP_004142979.1.48887 WP_004142979.1.48893 WP_004142979.1.48904 WP_004142979.1.4900 WP_004142979.1.49133 WP_004142979.1.49157 WP_004142979.1.49194 WP_004142979.1.49209 WP_004142979.1.49307 WP_004142979.1.49353 WP_004142979.1.49424 WP_004142979.1.49438 WP_004142979.1.49579 WP_004142979.1.49589 WP_004142979.1.49809 WP_004142979.1.49887 WP_004142979.1.49897 WP_004142979.1.49933 WP_004142979.1.50018 WP_004142979.1.50022 WP_004142979.1.50029 WP_004142979.1.5011 WP_004142979.1.50193 WP_004142979.1.50195 WP_004142979.1.5023 WP_004142979.1.50342 WP_004142979.1.50429 WP_004142979.1.50434 WP_004142979.1.50493 WP_004142979.1.50541 WP_004142979.1.50672 WP_004142979.1.50730 WP_004142979.1.50831 WP_004142979.1.50866 WP_004142979.1.50927 WP_004142979.1.50992 WP_004142979.1.51016 WP_004142979.1.51135 WP_004142979.1.51176 WP_004142979.1.51347 WP_004142979.1.51400 WP_004142979.1.51413 WP_004142979.1.5143 WP_004142979.1.51561 WP_004142979.1.51563 WP_004142979.1.517 WP_004142979.1.51743 WP_004142979.1.51791 WP_004142979.1.5181 WP_004142979.1.51922 WP_004142979.1.52012 WP_004142979.1.52021 WP_004142979.1.52051 WP_004142979.1.52054 WP_004142979.1.522 WP_004142979.1.52275 WP_004142979.1.52287 WP_004142979.1.5259 WP_004142979.1.52775 WP_004142979.1.52813 WP_004142979.1.52920 WP_004142979.1.53122 WP_004142979.1.53187 WP_004142979.1.53246 WP_004142979.1.53348 WP_004142979.1.53391 WP_004142979.1.53442 WP_004142979.1.53461 WP_004142979.1.53472 WP_004142979.1.53588 WP_004142979.1.53597 WP_004142979.1.53623 WP_004142979.1.53656 WP_004142979.1.53727 WP_004142979.1.53734 WP_004142979.1.540 WP_004142979.1.54045 WP_004142979.1.54353 WP_004142979.1.54556 WP_004142979.1.54676 WP_004142979.1.54786 WP_004142979.1.548 WP_004142979.1.54824 WP_004142979.1.54958 WP_004142979.1.55048 WP_004142979.1.55171 WP_004142979.1.55330 WP_004142979.1.55448 WP_004142979.1.55577 WP_004142979.1.55632 WP_004142979.1.55648 WP_004142979.1.55651 WP_004142979.1.55658 WP_004142979.1.55741 WP_004142979.1.5576 WP_004142979.1.55866 WP_004142979.1.56104 WP_004142979.1.56117 WP_004142979.1.56118 WP_004142979.1.56506 WP_004142979.1.56599 WP_004142979.1.56728 WP_004142979.1.56750 WP_004142979.1.5682 WP_004142979.1.56847 WP_004142979.1.57139 WP_004142979.1.57200 WP_004142979.1.57310 WP_004142979.1.57325 WP_004142979.1.57398 WP_004142979.1.57421 WP_004142979.1.57435 WP_004142979.1.57475 WP_004142979.1.57501 WP_004142979.1.57624 WP_004142979.1.57630 WP_004142979.1.57648 WP_004142979.1.57702 WP_004142979.1.57716 WP_004142979.1.57747 WP_004142979.1.57886 WP_004142979.1.5797 WP_004142979.1.58028 WP_004142979.1.58099 WP_004142979.1.58134 WP_004142979.1.58176 WP_004142979.1.58230 WP_004142979.1.58280 WP_004142979.1.58300 WP_004142979.1.58426 WP_004142979.1.58533 WP_004142979.1.58720 WP_004142979.1.58865 WP_004142979.1.58945 WP_004142979.1.58967 WP_004142979.1.58985 WP_004142979.1.5903 WP_004142979.1.59031 WP_004142979.1.59042 WP_004142979.1.59069 WP_004142979.1.59074 WP_004142979.1.59172 WP_004142979.1.59279 WP_004142979.1.5951 WP_004142979.1.59518 WP_004142979.1.59616 WP_004142979.1.59620 WP_004142979.1.59661 WP_004142979.1.59743 WP_004142979.1.59865 WP_004142979.1.59924 WP_004142979.1.59936 WP_004142979.1.59993 WP_004142979.1.60060 WP_004142979.1.60283 WP_004142979.1.60372 WP_004142979.1.60483 WP_004142979.1.60564 WP_004142979.1.60681 WP_004142979.1.60774 WP_004142979.1.60830 WP_004142979.1.60922 WP_004142979.1.60964 WP_004142979.1.60972 WP_004142979.1.60995 WP_004142979.1.61061 WP_004142979.1.61079 WP_004142979.1.61178 WP_004142979.1.61618 WP_004142979.1.61672 WP_004142979.1.61775 WP_004142979.1.61940 WP_004142979.1.62111 WP_004142979.1.62188 WP_004142979.1.62234 WP_004142979.1.62306 WP_004142979.1.62452 WP_004142979.1.62502 WP_004142979.1.62520 WP_004142979.1.62560 WP_004142979.1.62760 WP_004142979.1.62809 WP_004142979.1.63098 WP_004142979.1.63123 WP_004142979.1.6315 WP_004142979.1.63294 WP_004142979.1.63404 WP_004142979.1.6346 WP_004142979.1.63485 WP_004142979.1.63582 WP_004142979.1.63643 WP_004142979.1.63671 WP_004142979.1.63785 WP_004142979.1.63802 WP_004142979.1.6391 WP_004142979.1.63956 WP_004142979.1.64075 WP_004142979.1.64114 WP_004142979.1.64140 WP_004142979.1.64191 WP_004142979.1.64211 WP_004142979.1.64240 WP_004142979.1.6432 WP_004142979.1.6442 WP_004142979.1.64453 WP_004142979.1.64620 WP_004142979.1.64735 WP_004142979.1.6476 WP_004142979.1.64945 WP_004142979.1.65166 WP_004142979.1.6524 WP_004142979.1.65254 WP_004142979.1.65436 WP_004142979.1.65472 WP_004142979.1.65564 WP_004142979.1.65766 WP_004142979.1.65813 WP_004142979.1.6591 WP_004142979.1.660 WP_004142979.1.66020 WP_004142979.1.66070 WP_004142979.1.66080 WP_004142979.1.66236 WP_004142979.1.66271 WP_004142979.1.66292 WP_004142979.1.66294 WP_004142979.1.66409 WP_004142979.1.66415 WP_004142979.1.66434 WP_004142979.1.6644 WP_004142979.1.66481 WP_004142979.1.66529 WP_004142979.1.66547 WP_004142979.1.66568 WP_004142979.1.66613 WP_004142979.1.66709 WP_004142979.1.66714 WP_004142979.1.66857 WP_004142979.1.66895 WP_004142979.1.66989 WP_004142979.1.67399 WP_004142979.1.67591 WP_004142979.1.67765 WP_004142979.1.67805 WP_004142979.1.67855 WP_004142979.1.67858 WP_004142979.1.68090 WP_004142979.1.68189 WP_004142979.1.6823 WP_004142979.1.68403 WP_004142979.1.68491 WP_004142979.1.68507 WP_004142979.1.68511 WP_004142979.1.68533 WP_004142979.1.6868 WP_004142979.1.68848 WP_004142979.1.6885 WP_004142979.1.68891 WP_004142979.1.68969 WP_004142979.1.68986 WP_004142979.1.69002 WP_004142979.1.69055 WP_004142979.1.69062 WP_004142979.1.69153 WP_004142979.1.69212 WP_004142979.1.69459 WP_004142979.1.69613 WP_004142979.1.69691 WP_004142979.1.69755 WP_004142979.1.69861 WP_004142979.1.6997 WP_004142979.1.7000 WP_004142979.1.70050 WP_004142979.1.70140 WP_004142979.1.70499 WP_004142979.1.70519 WP_004142979.1.70543 WP_004142979.1.70666 WP_004142979.1.7072 WP_004142979.1.70765 WP_004142979.1.7087 WP_004142979.1.70966 WP_004142979.1.71056 WP_004142979.1.71092 WP_004142979.1.71100 WP_004142979.1.71241 WP_004142979.1.7136 WP_004142979.1.71504 WP_004142979.1.71611 WP_004142979.1.71634 WP_004142979.1.7168 WP_004142979.1.71720 WP_004142979.1.71804 WP_004142979.1.7181 WP_004142979.1.71990 WP_004142979.1.72154 WP_004142979.1.72214 WP_004142979.1.7223 WP_004142979.1.72341 WP_004142979.1.72406 WP_004142979.1.72482 WP_004142979.1.72575 WP_004142979.1.72688 WP_004142979.1.72713 WP_004142979.1.7273 WP_004142979.1.72765 WP_004142979.1.72899 WP_004142979.1.7320 WP_004142979.1.73236 WP_004142979.1.73319 WP_004142979.1.73510 WP_004142979.1.73558 WP_004142979.1.73635 WP_004142979.1.73689 WP_004142979.1.73691 WP_004142979.1.73770 WP_004142979.1.73780 WP_004142979.1.73887 WP_004142979.1.7390 WP_004142979.1.740 WP_004142979.1.74110 WP_004142979.1.74253 WP_004142979.1.74263 WP_004142979.1.74332 WP_004142979.1.74394 WP_004142979.1.74447 WP_004142979.1.74490 WP_004142979.1.74715 WP_004142979.1.74732 WP_004142979.1.74759 WP_004142979.1.74788 WP_004142979.1.74905 WP_004142979.1.74909 WP_004142979.1.74919 WP_004142979.1.7493 WP_004142979.1.75005 WP_004142979.1.75007 WP_004142979.1.7510 WP_004142979.1.75152 WP_004142979.1.75283 WP_004142979.1.75307 WP_004142979.1.75418 WP_004142979.1.75457 WP_004142979.1.75501 WP_004142979.1.75608 WP_004142979.1.75748 WP_004142979.1.75829 WP_004142979.1.75962 WP_004142979.1.76001 WP_004142979.1.76107 WP_004142979.1.76199 WP_004142979.1.76245 WP_004142979.1.7631 WP_004142979.1.76316 WP_004142979.1.76370 WP_004142979.1.76416 WP_004142979.1.76496 WP_004142979.1.76512 WP_004142979.1.76537 WP_004142979.1.76539 WP_004142979.1.76561 WP_004142979.1.76657 WP_004142979.1.76912 WP_004142979.1.76935 WP_004142979.1.76943 WP_004142979.1.76991 WP_004142979.1.77034 WP_004142979.1.7730 WP_004142979.1.77307 WP_004142979.1.77340 WP_004142979.1.77467 WP_004142979.1.77519 WP_004142979.1.77547 WP_004142979.1.77586 WP_004142979.1.77645 WP_004142979.1.77696 WP_004142979.1.777 WP_004142979.1.77723 WP_004142979.1.77799 WP_004142979.1.77831 WP_004142979.1.78012 WP_004142979.1.78062 WP_004142979.1.78065 WP_004142979.1.78103 WP_004142979.1.78119 WP_004142979.1.78268 WP_004142979.1.78290 WP_004142979.1.78300 WP_004142979.1.78354 WP_004142979.1.78387 WP_004142979.1.78417 WP_004142979.1.78418 WP_004142979.1.78421 WP_004142979.1.78533 WP_004142979.1.78540 WP_004142979.1.78597 WP_004142979.1.78613 WP_004142979.1.79021 WP_004142979.1.79211 WP_004142979.1.79236 WP_004142979.1.79520 WP_004142979.1.79582 WP_004142979.1.79599 WP_004142979.1.7974 WP_004142979.1.79756 WP_004142979.1.79857 WP_004142979.1.79935 WP_004142979.1.80047 WP_004142979.1.80350 WP_004142979.1.80355 WP_004142979.1.80412 WP_004142979.1.80466 WP_004142979.1.8054 WP_004142979.1.80554 WP_004142979.1.80615 WP_004142979.1.80692 WP_004142979.1.80704 WP_004142979.1.80767 WP_004142979.1.80816 WP_004142979.1.80829 WP_004142979.1.81139 WP_004142979.1.81159 WP_004142979.1.81285 WP_004142979.1.81329 WP_004142979.1.81350 WP_004142979.1.81431 WP_004142979.1.81488 WP_004142979.1.81544 WP_004142979.1.81569 WP_004142979.1.81675 WP_004142979.1.81744 WP_004142979.1.81908 WP_004142979.1.82211 WP_004142979.1.82238 WP_004142979.1.82370 WP_004142979.1.82399 WP_004142979.1.82452 WP_004142979.1.8252 WP_004142979.1.82659 WP_004142979.1.82704 WP_004142979.1.82767 WP_004142979.1.82769 WP_004142979.1.83300 WP_004142979.1.83337 WP_004142979.1.83379 WP_004142979.1.8356 WP_004142979.1.83691 WP_004142979.1.83872 WP_004142979.1.83948 WP_004142979.1.84224 WP_004142979.1.84226 WP_004142979.1.84335 WP_004142979.1.84377 WP_004142979.1.84417 WP_004142979.1.84553 WP_004142979.1.84569 WP_004142979.1.84627 WP_004142979.1.8464 WP_004142979.1.84650 WP_004142979.1.84737 WP_004142979.1.84783 WP_004142979.1.84801 WP_004142979.1.84890 WP_004142979.1.85115 WP_004142979.1.85263 WP_004142979.1.85390 WP_004142979.1.85487 WP_004142979.1.8549 WP_004142979.1.85497 WP_004142979.1.85523 WP_004142979.1.85539 WP_004142979.1.85571 WP_004142979.1.85622 WP_004142979.1.85702 WP_004142979.1.85731 WP_004142979.1.85812 WP_004142979.1.85877 WP_004142979.1.85957 WP_004142979.1.85960 WP_004142979.1.85965 WP_004142979.1.85970 WP_004142979.1.86031 WP_004142979.1.86039 WP_004142979.1.86194 WP_004142979.1.86203 WP_004142979.1.86339 WP_004142979.1.86384 WP_004142979.1.86533 WP_004142979.1.8667 WP_004142979.1.8668 WP_004142979.1.86737 WP_004142979.1.86899 WP_004142979.1.86932 WP_004142979.1.87 WP_004142979.1.87063 WP_004142979.1.87150 WP_004142979.1.87235 WP_004142979.1.87256 WP_004142979.1.87313 WP_004142979.1.87315 WP_004142979.1.87343 WP_004142979.1.87354 WP_004142979.1.87591 WP_004142979.1.87628 WP_004142979.1.87631 WP_004142979.1.87638 WP_004142979.1.87693 WP_004142979.1.87702 WP_004142979.1.87767 WP_004142979.1.87929 WP_004142979.1.87931 WP_004142979.1.88041 WP_004142979.1.8832 WP_004142979.1.88394 WP_004142979.1.88398 WP_004142979.1.88406 WP_004142979.1.88419 WP_004142979.1.88500 WP_004142979.1.8853 WP_004142979.1.88574 WP_004142979.1.88914 WP_004142979.1.8896 WP_004142979.1.89096 WP_004142979.1.89115 WP_004142979.1.89117 WP_004142979.1.89118 WP_004142979.1.89142 WP_004142979.1.89154 WP_004142979.1.89185 WP_004142979.1.89226 WP_004142979.1.89300 WP_004142979.1.89327 WP_004142979.1.89401 WP_004142979.1.89430 WP_004142979.1.8952 WP_004142979.1.89524 WP_004142979.1.89530 WP_004142979.1.89558 WP_004142979.1.89593 WP_004142979.1.89618 WP_004142979.1.8966 WP_004142979.1.89688 WP_004142979.1.89919 WP_004142979.1.89961 WP_004142979.1.8999 WP_004142979.1.9012 WP_004142979.1.90123 WP_004142979.1.90318 WP_004142979.1.90382 WP_004142979.1.90446 WP_004142979.1.90493 WP_004142979.1.90516 WP_004142979.1.90581 WP_004142979.1.90621 WP_004142979.1.90636 WP_004142979.1.90746 WP_004142979.1.90879 WP_004142979.1.91001 WP_004142979.1.91181 WP_004142979.1.91242 WP_004142979.1.91298 WP_004142979.1.91301 WP_004142979.1.91327 WP_004142979.1.91415 WP_004142979.1.91444 WP_004142979.1.91452 WP_004142979.1.91484 WP_004142979.1.91522 WP_004142979.1.91534 WP_004142979.1.91544 WP_004142979.1.91676 WP_004142979.1.91678 WP_004142979.1.91684 WP_004142979.1.91729 WP_004142979.1.91751 WP_004142979.1.92046 WP_004142979.1.92084 WP_004142979.1.9216 WP_004142979.1.92280 WP_004142979.1.92460 WP_004142979.1.925 WP_004142979.1.92704 WP_004142979.1.92746 WP_004142979.1.92799 WP_004142979.1.92873 WP_004142979.1.92901 WP_004142979.1.92984 WP_004142979.1.93031 WP_004142979.1.93131 WP_004142979.1.93161 WP_004142979.1.93226 WP_004142979.1.93308 WP_004142979.1.93342 WP_004142979.1.93369 WP_004142979.1.93502 WP_004142979.1.93757 WP_004142979.1.93764 WP_004142979.1.93879 WP_004142979.1.94033 WP_004142979.1.94216 WP_004142979.1.94493 WP_004142979.1.94518 WP_004142979.1.94608 WP_004142979.1.94696 WP_004142979.1.94701 WP_004142979.1.94721 WP_004142979.1.94860 WP_004142979.1.94871 WP_004142979.1.94909 WP_004142979.1.95102 WP_004142979.1.9511 WP_004142979.1.95189 WP_004142979.1.9521 WP_004142979.1.95238 WP_004142979.1.95349 WP_004142979.1.95405 WP_004142979.1.95408 WP_004142979.1.95562 WP_004142979.1.95697 WP_004142979.1.95754 WP_004142979.1.95775 WP_004142979.1.95898 WP_004142979.1.95927 WP_004142979.1.96010 WP_004142979.1.96131 WP_004142979.1.96225 WP_004142979.1.96300 WP_004142979.1.96374 WP_004142979.1.96645 WP_004142979.1.96737 WP_004142979.1.96774 WP_004142979.1.96881 WP_004142979.1.96991 WP_004142979.1.97025 WP_004142979.1.97092 WP_004142979.1.97186 WP_004142979.1.97273 WP_004142979.1.97353 WP_004142979.1.9745 WP_004142979.1.97463 WP_004142979.1.97500 WP_004142979.1.97567 WP_004142979.1.97636 WP_004142979.1.97697 WP_004142979.1.97728 WP_004142979.1.97773 WP_004142979.1.97855 WP_004142979.1.9800 WP_004142979.1.98016 WP_004142979.1.9831 WP_004142979.1.98342 WP_004142979.1.98420 WP_004142979.1.98499 WP_004142979.1.98631 WP_004142979.1.98673 WP_004142979.1.98794 WP_004142979.1.98816 WP_004142979.1.99007 WP_004142979.1.99013 WP_004142979.1.99016 WP_004142979.1.99245 WP_004142979.1.99264 WP_004142979.1.9934 WP_004142979.1.99348 WP_004142979.1.99439 WP_004142979.1.99705 WP_004142979.1.99794 WP_004142979.1.99873 WP_004142979.1.99944 WP_004142979.1.9996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]