SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 484021.KP1_2455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  484021.KP1_2455
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.5e-119
Family PFOR PP module 0.0000000328
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-75
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000961
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.12e-74
Family PFOR Pyr module 0.000000074
Further Details:      
 
Domain Number 4 Region: 255-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.99e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000202
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.64e-22
Family Ferredoxin domains from multidomain proteins 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 484021.KP1_2455
Sequence length 1175
Comment (Klebsiella pneumoniae NTUH K2044)
Sequence
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDVPRVVEMQSE
AGAIGAVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGQLMPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCASSVQEAQDFALISHIATLQSRVPFIHFFDGFRTSHEINKIA
PLADDTIRALLPQDKIAEHRQRALNPEHPVIRGTSANPDTYFQSREATNPWYDAVYDHVE
KAMDDFAAATGRQYKPFEFYGHPQAERVIFIMGSAIGTCEEVVDELLSRGEKVGVLKVRL
YRPFSAAHLLAALPESARAVAVLDRTKEPGALAEPLYLDVMTALAEAFNRGERETLPRTI
GGRYGLSSKEFGPECVLAIFSELQAAQPKPRFTVGIYDDVTNLSLPLGENTLPAEAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWFSQGYFVYDSKKAGGLTVSHLRVSEKPIRSSYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQATLNQKKARF
YVVNAAKIARECSLGARINTVMQMAFFHLTQILPGDSALAELQAAIAKSYSSKGQELVER
NWQALALARESLAEVPLQPVNASSPNRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEALCTQCNHCVAACPHSAIRAKVVAPEEMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KVNYEYFLNLPEIDRSKLERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRQRVLRL
LSEFADKLPAELNAALHAEATPEVRREQVAALRQALAGVAGAEELLTDADALVEKSVWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRAEEGKIPLALDSRPPSDALAETLLNEQRFRRLNAQQP
EVAEQLWKDAAADLQKRYDFLAQLAGKAEKSPSEG
Download sequence
Identical sequences A0A1B2ZM84
WP_014907692.1.100635 WP_014907692.1.101332 WP_014907692.1.12939 WP_014907692.1.1513 WP_014907692.1.19533 WP_014907692.1.28375 WP_014907692.1.33057 WP_014907692.1.33806 WP_014907692.1.3640 WP_014907692.1.43084 WP_014907692.1.46199 WP_014907692.1.46327 WP_014907692.1.58280 WP_014907692.1.60995 WP_014907692.1.6391 WP_014907692.1.66409 WP_014907692.1.66434 WP_014907692.1.66989 WP_014907692.1.75152 WP_014907692.1.81159 WP_014907692.1.81544 WP_014907692.1.81744 WP_014907692.1.83948 WP_014907692.1.8832 WP_014907692.1.93161 WP_014907692.1.96645 WP_014907692.1.97728 gi|402781034|ref|YP_006636580.1| 484021.KP1_2455 gi|238894465|ref|YP_002919199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]