SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 484021.KP1_2941 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  484021.KP1_2941
Domain Number 1 Region: 139-394
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.01e-60
Family D-glucarate dehydratase-like 0.00000184
Further Details:      
 
Domain Number 2 Region: 27-152
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.09e-31
Family Enolase N-terminal domain-like 0.00000906
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 484021.KP1_2941
Sequence length 395
Comment (Klebsiella pneumoniae NTUH K2044)
Sequence
MSMAQTPVMDVGTKSYISHQEQKMTATVEQIESWIVDVPTIRPHKLSMTTMGCQSLVIVR
LTRSDGICGIGEATTIGGLSYGVESPEAISSAITHYLTPLLKGQPADNLNALTARMNGAI
KGNTFAKSAIETALLDAQGKALGLPISALLGGALQTALPVLWTLASGDTAKDIAEGEKLL
AEGRHRAFKLKIGARELATDLRHTRAIVEALGDRASIRVDVNQAWDAATGAKGCRELAAM
GVDLIEQPVSAHDNAALVRLSQQIETAILADEAVATAYDGYQLAQQGFTGAYALKIAKAG
GPNSVLALARVAQAAGIGLYGGTMLEGTVGTVASLHAWSTLPLQWGTEMFGPLLLKDDIV
SVPLTFADGQVALPQTPGLGVELDEDKLHFYTRQP
Download sequence
Identical sequences 484021.KP1_2941 gi|238894918|ref|YP_002919652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]