SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 484022.Fphi_1647 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  484022.Fphi_1647
Domain Number 1 Region: 129-347
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.49e-52
Family D-glucarate dehydratase-like 0.0000831
Further Details:      
 
Domain Number 2 Region: 3-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.88e-26
Family Enolase N-terminal domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 484022.Fphi_1647
Sequence length 356
Comment (Francisella philomiragia ATCC 25017)
Sequence
MSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTL
QGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISV
AKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDN
EFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIP
VVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMES
PAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNL
Download sequence
Identical sequences B0TZW0
gi|167627873|ref|YP_001678373.1| 484022.Fphi_1647 WP_012280945.1.52285 WP_012280945.1.74593 WP_012280945.1.94027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]