SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485914.Hmuk_0321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485914.Hmuk_0321
Domain Number 1 Region: 125-409
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.68e-78
Family D-glucarate dehydratase-like 0.0000468
Further Details:      
 
Domain Number 2 Region: 31-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.98e-27
Family Enolase N-terminal domain-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 485914.Hmuk_0321
Sequence length 411
Comment (Halomicrobium mukohataei DSM 12286)
Sequence
MYEDFASTLAATMWADFDEQPRRADGPPGEITDVQTVVVDGNFPWTIVTVETSEGVTGIG
ECYPSPGVHEVITDYLRPVLVGENPTDVERLYNLMRESLSGRGSQQGIGTIAISGVEIAL
WDATGKLLDQPIYQLLGGKLRESVAVYADCHAGEAMVESAREGQEASTYDPQAYARAARG
AVDDGFDIVKFDLDVPSGREIDTLSRHFDPPEIEHKRRVVEAVTDEIGHDAEVAVDLHWN
FSPETAERLCRAIEPYDLAWIEDPLPPENTDAMRELKRRVDVTLLTGENRYGRHGFRDLV
AEQAVDFLAPDVPKTGGIAETKKIAELAETYYQALVPHNIGSPVATAATVHVGATVPNFV
ALEYHAREVSWWDDLLVRDEPFIRDGRIRVPDGPGLGVELDWDAVEDHRKH
Download sequence
Identical sequences C7NX93
gi|257386392|ref|YP_003176165.1| WP_012807851.1.83741 485914.Hmuk_0321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]