SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485914.Hmuk_1379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485914.Hmuk_1379
Domain Number 1 Region: 127-325
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.45e-62
Family D-glucarate dehydratase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.01e-20
Family Enolase N-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 485914.Hmuk_1379
Sequence length 342
Comment (Halomicrobium mukohataei DSM 12286)
Sequence
MRFSFQRHELPTDDPFGIARGTTTTAAVVTVEITHEGTTGVGGAAPSEYYGETAASVRDA
LEALRPVVEAWDDPHAGQRVANALATRLPDAAAARAAVSTALADLAARDLGVPCYRQWGL
DPAAAPRTSYTVAIADPETMAERAERAVAAGYDTLKVKVGTDDDRSRIRAVRRGAPDATL
RVDANCAWSPAEAIEQAGWLAERDVQFLEQPVAADDLDGLERVASATSLPICADESCVAA
PDVPRVADACDLVTVKLMKCGGVRPAVEQIHAAHAHGLDVMLGCMLESNASIAPAWHLAP
LVEYADLDGAALLSRDPYAGVSLDGRRADLGSITRGTGARRC
Download sequence
Identical sequences C7P328
gi|257387434|ref|YP_003177207.1| WP_015762346.1.83741 485914.Hmuk_1379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]