SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485914.Hmuk_2991 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  485914.Hmuk_2991
Domain Number - Region: 90-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0549
Family NfeD domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 485914.Hmuk_2991
Sequence length 190
Comment (Halomicrobium mukohataei DSM 12286)
Sequence
MSLLSESLSTLLFVGGALLLVAEAVAPGAHFFVLGVALLTAGVVGLFSPVGGALGILVLA
AAVLVATGLTLWGYRRLDIYDGEGSAQTLDSNSLRGKFGRVTERVTQTDGEVKLQDAGFN
PYYQARSVDGEIEEGAEVMVVDPGGGNVVTVEAVSGGDAIDRQLETDREQSVTDAEPERE
FDPDAESDAA
Download sequence
Identical sequences C7P1K6
gi|257389030|ref|YP_003178803.1| 485914.Hmuk_2991 WP_015763938.1.83741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]