SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485915.Dret_1025 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485915.Dret_1025
Domain Number 1 Region: 23-204
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.53e-25
Family Clp protease, ClpP subunit 0.026
Further Details:      
 
Domain Number 2 Region: 379-442
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000732
Family NfeD domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 485915.Dret_1025
Sequence length 453
Comment (Desulfohalobium retbaense DSM 5692)
Sequence
MSAPSCHQVWFRHGSACLLGLLILFLAGTAGHSQSSPNLRALSVRLEGAITPAQADLLAE
SLQKAREQNFDFFVIELDTPGGLGASMRDMVKTILNAPLPVCIWVGPRGARAASAGVFLV
ASGHINAMSPQTTIGAASPVSLGGQDMNSTMGQKIKNDFLSLIRGIATSRGRNAEWYEKA
VDEAATLTAQEAAAQDVVDYLADSPIEALVKAGAEGFTFEDRSYAFSQQQIAVTPYTLPL
RYRFLSWLLHPQIAYFLLLGGIAGLFFELSHPGAVFPGVFGAICLLLAMYALAILPTNIA
GVLLLLLAFVLFLLELAITSFGLLTVGGLICLLLGSTLLFRSGFGFAPLGLDVVLPTVLL
VAAFVVGVVYLVTKIQIRPRQSGEQAMIGLRGKVVTAQGDRGRIKVRGELWNASSEMGHA
LHEGQKVEVVGVKGLDLVVRPLTDQSPLEVSHG
Download sequence
Identical sequences C8X1Z0
485915.Dret_1025 gi|258405149|ref|YP_003197891.1| WP_015751464.1.45754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]