SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485916.Dtox_4351 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485916.Dtox_4351
Domain Number 1 Region: 57-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.7e-26
Family Ribosomal protein L9 C-domain 0.00048
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.62e-16
Family Ribosomal protein L9 N-domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 485916.Dtox_4351
Sequence length 148
Comment (Desulfotomaculum acetoxidans DSM 771)
Sequence
MKIILNQDVAKLGRKGDVLDVAEGYARNYLLPRGLAAEASKSKMNDLERQKSIEEDRKLK
IKQKSEQLAEKINNLTVKIFARVGENGKLFGAVGNNDIAKALSDQFKVDIDKKKIVLKDT
IKTIGEYKAILKLHTSVQAEINVEVLPQ
Download sequence
Identical sequences C8W046
WP_015759683.1.30109 485916.Dtox_4351 gi|258517415|ref|YP_003193637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]