SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 485917.Phep_1692 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485917.Phep_1692
Domain Number 1 Region: 209-397
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0000000000000563
Family D-glucarate dehydratase-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 485917.Phep_1692
Sequence length 461
Comment (Pedobacter heparinus DSM 2366)
Sequence
MINRRAFIKNTSLIAAFSGNSFDTLALPATKTMKNIKIIETDADFEREKLVRPFGFKGGY
LTELWQVASQLKSDTGISRTGLATQSVLYGDADLFAQHTEAGGNALMFLVVNKALELIKQ
TPFSNPITLLDTIFPELVAEAKQLTGRSDLNINFVYNALISTDNAAWLIYAAEHNCKTFD
EMIPESYQKGLSFRNDKIAIMYQVPYGMPVEDLKVAASEGYFVFKIKTGHPGSQSEMLQK
DMEKLSQVHAVLKDLRTSYTPNGKLIYTMDANGRYERKDLLMRYLDHAKKIGAFDHILFY
EEPLTEQNEENVSDLGIRIGADESVHNEAGAIRRIEQGYEALVLKGIAKTLSMSVKIAKL
AAEREIPCLCADLTVNPILIDWNKNLAARLAPFPGLGMGLMETNGDMNYRNWKNMLSYHP
AASASWTKPKNGIFELDEAYYAQSGGIFEPSVHYNALFNKG
Download sequence
Identical sequences C6XUQ3
485917.Phep_1692 gi|255531593|ref|YP_003091965.1| WP_015807517.1.64783 WP_015807517.1.66710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]