SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485918.Cpin_5626 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485918.Cpin_5626
Domain Number 1 Region: 237-284
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000125
Family AraC type transcriptional activator 0.015
Further Details:      
 
Domain Number 2 Region: 38-166
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0000000000445
Family Regulatory protein AraC 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 485918.Cpin_5626
Sequence length 285
Comment (Chitinophaga pinensis DSM 2588)
Sequence
MDSIPIRHIHTTPQQQESSYRFSIRNVQNLLAGEDMHESLHRHDFFYLLILKKGSGQHHI
DFKSYTIEGHSLFLVRPGQVHELTLHADCSGYLLQFSEGFYTAQDQQNRRLLRKAGSINH
YTFDARRFQKITGILQYISDEYTLQEERYQEAIKANLSFLFIELLRDQRHTASTKEPRYF
QERLDTFLELVETHFVEYKQVSQYAAMMHLTTYQLNAITKQTLDKTCSEVINDYIILEAR
RQLRATTEQINNIAFRLGYEDVSYFIRFFKKHTAYTPDAFRQNCR
Download sequence
Identical sequences C7PBI6
gi|256424598|ref|YP_003125251.1| 485918.Cpin_5626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]