SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 486410.SDEG_1825 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  486410.SDEG_1825
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.75e-35
Family Chaperone J-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 268-353
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.14e-22
Family HSP40/DnaJ peptide-binding domain 0.0014
Further Details:      
 
Domain Number 3 Region: 139-219
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 5.89e-20
Family DnaJ/Hsp40 cysteine-rich domain 0.00024
Further Details:      
 
Domain Number 4 Region: 119-143,209-269
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 5.49e-19
Family HSP40/DnaJ peptide-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 486410.SDEG_1825
Sequence length 383
Comment (Streptococcus dysgalactiae equisimilis GGS 124)
Sequence
MVSYIMNNTEYYDRLGVSKDASQDDIKKAYRKMSKKYHPDINKEAGAEQKYKDVQEAYET
LSDSQKRAAYDQYGAAGANGGFGGGAGGFGGFDGGGFGGFEDIFSSFFGGGGMRNPNAPR
QGDDLQYRVNLSFEEAVFGVEKEVSYNREATCGTCSGSGAKPGTSPVTCHKCHGSGVMTV
DTQTPLGMMRRQVTCDVCHGTGQEIKEPCPTCHGTGHKKKVHKVSVKIPAGVETGQQIRL
QGQGEAGFNGGPYGDLFVILNVLPSKKFERNGSTIYYSLDISFTQAALGDTVDIPTVHGD
VEMAIPAGTQTGKTFRLKGKGAPKLRGGGQGDQHVTVNIVTPTKLNDAQKEALKAFAEAS
GEQPLHPKKKGFFDKVKDALEDI
Download sequence
Identical sequences C5WIU2
gi|251783216|ref|YP_002997521.1| 486410.SDEG_1825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]