SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4896.SPAP27G11.15-1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4896.SPAP27G11.15-1
Domain Number 1 Region: 6-84
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.000000405
Family GIY-YIG endonuclease 0.006
Further Details:      
 
Weak hits

Sequence:  4896.SPAP27G11.15-1
Domain Number - Region: 114-158
Classification Level Classification E-value
Superfamily Homeodomain-like 0.095
Family Centromere-binding 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4896.SPAP27G11.15-1
Sequence length 271
Comment (Schizosaccharomyces pombe)
Sequence
MDLCNFYCCYLLKSNRTQSSGAVYIGSTPDPPRRLRQHNGEIVGGASKTKHGRPWSISCL
VYGFPNKVSALKFEWNWQNLGISRYTKDCDFRSKKQKTIMYCLKGLKHLVDSDTWRRWPL
NITFLNKTAFSKWNQLGKTYGNINVYFDEEWLNGFHEKVIQKTYDHKLCLRKTISEPVKC
NLCYECIESDELRANCPFTDCNSINHLTCLASSFLTEECQVLPIEGMCTKCKRVLRWREF
LSTVFTTSLETDERDFESENRIEIIDLELEK
Download sequence
Identical sequences Q9P7M3
4896.SPAP27G11.15-1 SPAP27G11.15 NP_593420.1.19918 SPAP27G11_15.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]