SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 490899.DKAM_0447 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  490899.DKAM_0447
Domain Number 1 Region: 46-198
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.31e-18
Family Clp protease, ClpP subunit 0.023
Further Details:      
 
Domain Number 2 Region: 388-445
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000432
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 490899.DKAM_0447
Sequence length 450
Comment (Desulfurococcus kamchatkensis 1221n)
Sequence
MVRNPLLFFALVIVVALLIQVISISGDNSQAYTRTINQAIVLDITPPFDTIDTGIAECFM
DALREAESTGSLLIYRVNSYGGLLDAGFTIGDAVLYSKTPTVAYVETKALSAATLIILPA
NIIALQRYSTIGDMQPVMVDPLTGQIQFINEPKILNPIIEKAKTYASRSNRNQTIIEEFV
THALTINSSLAIASRVADLEVENFDELLTTLNGAHVRIGDTEYVLNIDRGMMKTFSCSIR
SRIISILSNSYIANILTTIGMLATIFALVSGKLAILPLTIGMLLLGLVGTGFSANMVSAF
LIILGALLLALELFVIPGFGVVGVSGIILLTLGFALLPVYVPTGVSPSGEYIAVLRLYIL
VISLFLGGVFGIVIYKVAKVRRKKPVEFLPVSKKGRAIDELKPGSIGFVVVEGEYWRAVS
NEYIAPGEEVIVEEMLENGVLRVRKKTDNH
Download sequence
Identical sequences B8D3U2
gi|218883758|ref|YP_002428140.1| WP_012608115.1.40753 490899.DKAM_0447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]