SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 490899.DKAM_0533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  490899.DKAM_0533
Domain Number 1 Region: 2-175
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.83e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 490899.DKAM_0533
Sequence length 176
Comment (Desulfurococcus kamchatkensis 1221n)
Sequence
MKVEVLIIGRGGQGVLLLGRILGLSISKYAGKYAVATETYAAETRGGESRTDIVIGDSMH
DVDYVKVQSPDIAVFMYPFNLDKYLKMLRPTTMVFIDEEYVDPGLFTGFKLFHHRYSEIA
ESRLGTRRVANVVIAGHMARATSIWSLEHLKKTVVDLTPEKWHQLNIKALELGYSL
Download sequence
Identical sequences B8D428
WP_012608201.1.40753 490899.DKAM_0533 gi|218883844|ref|YP_002428226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]