SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 491915.Aflv_0842 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  491915.Aflv_0842
Domain Number 1 Region: 159-219
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000157
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 491915.Aflv_0842
Sequence length 226
Comment (Anoxybacillus flavithermus WK1)
Sequence
MKGGEVMVGFIVAFTHPFLAALLLIAGSVLFVWQLYDARWGWKGTMSLICFLLFFSSHLA
AGLTGFGAIVLFLIGLILLVIELFVPGGVIGFLGLGTLVWSLFLAAKHSSFITVSLAIAI
VSAVIVGLWLSRVSKQKMALFEKIVLTDEQRNEEGYVSHEVRMDLVGKRGVAITVLRPAG
TALIDGERVDVVTEGEYIERHRPIEVIHVDGLKVVVRECKKEEEIV
Download sequence
Identical sequences B7GKD5
WP_012574510.1.82098 491915.Aflv_0842 gi|212638685|ref|YP_002315205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]