SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 491915.Aflv_2768 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  491915.Aflv_2768
Domain Number 1 Region: 93-233
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.14e-40
Family Potassium channel NAD-binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.76e-26
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 3 Region: 240-315
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 2.88e-18
Family TrkA C-terminal domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 491915.Aflv_2768
Sequence length 318
Comment (Anoxybacillus flavithermus WK1)
Sequence
MIVAIIAGTVGFMFSEQLTFFDALWLTVVTILTVGYGDTVPQTFYGKMFALIIIPVGISI
VTYATGAVVSMMMEGEFSKTVRRRKMKKKIETMTNHIIVCGFGRVGEQVVRELVKNGTSV
VVVERNVDWLEEMGDPIPYVEGDATEDDVLIAAGIDRAAGLVAALPSDADNVFISLTAKG
LNPNIQVVARAERTESEEKLRRAGADKVINPAFLSGRRMAMTMLKPVSVDYVDTIFHDRA
EQYAIEEITIESHSSFVGTSVRDQAVRTRFRVTIIAIQRQNNMIGNPTPEERFFVGDILI
VFGEKRALEAFEQEVNKK
Download sequence
Identical sequences B7GML9
491915.Aflv_2768 gi|212640586|ref|YP_002317106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]