SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4924.PICST_85654 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4924.PICST_85654
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.62e-36
Family Chaperone J-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 112-145,211-254
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 8.89e-19
Family HSP40/DnaJ peptide-binding domain 0.00023
Further Details:      
 
Domain Number 3 Region: 256-338
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 7.85e-18
Family HSP40/DnaJ peptide-binding domain 0.0000623
Further Details:      
 
Domain Number 4 Region: 137-207
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 2.35e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4924.PICST_85654
Sequence length 404
Comment (Pichia stipitis)
Sequence
MVKETKFYDVLGVSPSASDSEMKKAYRKAALKYHPDKNPSPEAAEKFKEISHAYEILSDD
QKREIYDSYGEEGLSGQGGPGGMGAEDIFSQFFGGGFGGMGGGPQRPSRGKDIKHSISCT
LEELYKGRTAKLALNKTILCKTCNGLGGKEGKIKKCSGCNGSGMKFVTRQMGPMIQRFQT
VCDQCQGTGDICDPKDRCTACKGKKTQAERKILQVHIDPGMKDGQRVVFSGEGDQEPGIT
PGDVVFVVDEKQHDKYTRKGNDLYYEAEVDLLTALAGGEIAFKHVSGDYIKIDIIPGDVI
SPGLVKVVENQGMPVYRQGGRGNLFIKFNIKFPAKNFTSEENLKTLESVLPARTKVSIPK
GAEVDDVEIVDVDPYKHSNNRRDTYDSDEEEGGQGGAGVQCASQ
Download sequence
Identical sequences A3M086
4924.PICST_85654 XP_001386701.2.38308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]