SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4929.A5DGE0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4929.A5DGE0
Domain Number 1 Region: 720-944
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.28e-68
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 946-1107
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 6.55e-35
Family NADPH-cytochrome p450 reductase-like 0.0008
Further Details:      
 
Domain Number 3 Region: 430-617
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0023
Further Details:      
 
Domain Number 4 Region: 278-399
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000236
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4929.A5DGE0
Sequence length 1107
Comment (Pichia guilliermondii)
Sequence
MSPHALASSASSEHGSKVSVSSSFATVKSNPFGAVADPSSVQNSSYLSASTIINQSLYAI
SSKIFSYEAPGAENLLDAHLQLWSQHYGRQNAFGVVPFFHKFQVRSGAANAILGYYSKNG
TSGQPLSTVVPANALVYMRPTLTTSRSGDLPLSLNVSAIDYDEQTNSLVSNYISALSVAR
SLEYPVISPVDSTNGLELQHLTVLNHFIAAMSGNPSILLADGPEFSKTFTRFDGLLPYSD
LGSLYQNLLAGANAESSDLVGYALDRLNTIAGTSYSQFEYSGSISPNVVYVVYGAHEATQ
LSSVVDRVGNIAKIGLIKVRVPLPFNAAKFASVVPSSTKKLVVLSQHNVSKNVSTSLKAD
VTSALFLSGRYHTLAVDGFSYPLDFVWSPVTIAKLFAEYDSSWNPAAALVEPDYFKDENI
TANTSPEGKYLVWGHDNGTFVEVSNKVALSLSLDEKKKVLIRNKFDNSRGGGLFQAQITC
APKVVGASTVDSADVILVEDVSVLANYDVLATAKPGATILLGNKKPIKTSIEEDVVPKLP
TGFKRGLAKNHNKLVLIDFSIVDDLDQISDSTKGFSEDFLTQVGFWRSAYPELNGFIVNK
LLQANGNSFELLAAVLDKFIATVDEKQGLKPVEVAKEWGNLQDEVAEKEEEQKEKEEEQK
EEPEQLPFFPTESSFFPNPRIVTEDAEETVDGTASDLAKKFTFAEAYDVKTDLRPDLPVK
NFVVKVQENRRLTPAEYSRNIFHIEFDISGTGLTYDIGEALGIHGRNNSEAVEKFLEFYG
VDGDSIVQVTSKENASVLEVRSARQALYDNVDFLGKPPKRFYEALAEHATNEKEKAHLEK
LASSEGAEELKKRQDVDFDTFVDILEEFPSARPSFSELVRIIPPLKRREYSIASSQKLHP
NAVHLLIVVVDWVDPKGRLRYGHASKYLSDLKIGDELVVSVKPSVMKLPPLSTQPIIMSG
LGTGLAPFKAFIEEKIWQKQQGMEIGEIYLYMGSRHKKEEYLYGELWEAYKDAGVLTHIG
AAFSRDQPQKIYIQDKIRESIEPLTEAFVEKNGSFYLCGPTWPVPDITACLQDIVTNGAR
KNGTEVKEVAKVVEELKEEGRYILEVY
Download sequence
Identical sequences A5DGE0
4929.A5DGE0 PGUT_02341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]