SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YJR060W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YJR060W
Domain Number 1 Region: 217-279
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  4932.YJR060W
Domain Number - Region: 266-335
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 0.0222
Family USP8 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4932.YJR060W
Sequence length 351
Comment (Saccharomyces cerevisiae)
Sequence
MNSLANNNKLSTEDEEIHSARKRGYNEEQNYSEARKKQRDQGLLSQESNDGNIDSALLSE
GATLKGTQSQYESGLTSNKDEKGSDDEDASVAEAAVAATVNYTDLIQGQEDSSDAHTSNQ
TNANGEHKDSLNGERAITPSNEGVKPNTSLEGMTSSPMESTQQSKNDMLIPLAEHDRGPE
HQQDDEDNDDADIDLKKDISMQPGRRGRKPTTLATTDEWKKQRKDSHKEVERRRRENINT
AINVLSDLLPVRESSKAAILACAAEYIQKLKETDEANIEKWTLQKLLSEQNASQLASANE
KLQEELGNAYKEIEYMKRVLRKEGIEYEDMHTHKKQENERKSTRSDNPHEA
Download sequence
Identical sequences P17106
4932.YJR060W YJR060W YJR060W NP_012594.1.97178 YJR060W YJR060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]