SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4932.YPR154W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4932.YPR154W
Domain Number 1 Region: 50-125
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-22
Family SH3-domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4932.YPR154W
Sequence length 215
Comment (Saccharomyces cerevisiae)
Sequence
MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASLEYVE
ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGPSN
LPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQQQQH
QSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF
Download sequence
Identical sequences N1NVL9 Q06449
YPR154W YPR154W YPR154W YPR154W YPR154W NP_015480.1.97178 4932.YPR154W YPR154W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]