SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4952.Q6C0N1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  4952.Q6C0N1
Domain Number - Region: 31-115
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.00432
Family Supernatant protein factor (SPF), C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4952.Q6C0N1
Sequence length 221
Comment (Yarrowia lipolytica)
Sequence
MRLILLLALLLASFTYAHDARFRFLLEPGTENCFYEDVRKIGNFIEYSYKVEKGGASGLQ
FVVRDPAKNIVTEDRTKLKIIKKKFLSKSWGEYQFCFRHVLPYFPEKKIEFMYNSVEDPL
MEPLTHEQKNPIHPGTIEAAAEYEGVEDQLTKVELAVSRSYSKLDDLWDRLNEDIDVTHK
VAVNFSRGNLGIVALTILVAVTQVYLIEVYIIGERDVDKSA
Download sequence
Identical sequences A0A1D8NPN8 Q6C0N1
gnl|GLV|YALI0F23265g 4952.Q6C0N1 XP_505781.1.88470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]