SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4952.Q6C9W0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4952.Q6C9W0
Domain Number 1 Region: 6-168
Classification Level Classification E-value
Superfamily UBC-like 2.54e-50
Family UBC-related 0.00000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4952.Q6C9W0
Sequence length 179
Comment (Yarrowia lipolytica)
Sequence
MLKIWSMKEKQAAEGGSAKKKVTAAQLRVQKDLSELSLPSTMKTHFPSAEDIMNFELTVR
PDEGFYQGGEFRFSFYVNPNFPHEPPKVKCLQKVYHPNIDLEGNVCLNILREDWKPVLSL
NAVMIGLQYLFLEPNASDPLNKDAAHQMTANREEFKRNVKHSMAGGSVAGERFDCVLIK
Download sequence
Identical sequences A0A1H6PYY8 Q6C9W0
XP_502552.1.88470 4952.Q6C9W0 gnl|GLV|YALI0D07890g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]