SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4959.Q6BPJ1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4959.Q6BPJ1
Domain Number 1 Region: 10-152
Classification Level Classification E-value
Superfamily Cyclin-like 4.16e-22
Family Cyclin 0.014
Further Details:      
 
Weak hits

Sequence:  4959.Q6BPJ1
Domain Number - Region: 185-237
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4959.Q6BPJ1
Sequence length 288
Comment (Debaryomyces hansenii)
Sequence
MSSIDLKALNIFLNSPVSQDMIHKLVVTTLQVLPCEDSKLQSPSNSSSKDKALPSLMTFI
TKLVRYTNVYTGTLMATLVYLNKLKTKLPKNAHGLPCTRHRILLSCLILSSKFHNDSSPK
NIHWANYTDGLFNVKDINLMERQLLFLLNWDLKVSNEDMIAHLGRFLNPIKEDLIKSAKM
RKFLQKQQQQQQQRQLQQQHQQTPRMSRSSSNSSTLSLHYRQSSTSSISTASSVDSSMES
SPTSKLHSPSHSHILYENKVDPMIEFTALSEERKLNRMLQELNSTTHY
Download sequence
Identical sequences Q6BPJ1
XP_459879.1.41535 4959.Q6BPJ1 gnl|GLV|DEHA2E13200g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]