SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4959.Q6BR04 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4959.Q6BR04
Domain Number 1 Region: 25-55
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000000109
Family Zn2/Cys6 DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4959.Q6BR04
Sequence length 57
Comment (Debaryomyces hansenii)
Sequence
MTKTTNSSVNKVQKDKHKFVLVEDAKISRSCDFCKSKKVKCDGNKPSCNYCLNHGTY
Download sequence
Identical sequences Q6BR04
gnl|GLV|DEHA2E00858g 4959.Q6BR04 XP_459366.1.41535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]