SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 498211.CJA_1077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498211.CJA_1077
Domain Number 1 Region: 94-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000589
Family NfeD domain-like 0.0076
Further Details:      
 
Domain Number 2 Region: 28-96
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000000876
Family Glycerol-3-phosphate transporter 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 498211.CJA_1077
Sequence length 158
Comment (Cellvibrio japonicus Ueda107)
Sequence
MIDFFLNLQAWHWLTLGIFVLILELLGAGGFLLGIGIASLVVASVLALVPGLGWHWQFVI
FAVLSVVVTLVYWKRFRRFNEKTEQPLLNSRVQRLIGRKVPLLTPITNGRGKVQIEDALW
TVSATRELAQGTAVVVTGAEGMTLLVEAVETVADESST
Download sequence
Identical sequences B3PBA5
WP_012486725.1.61722 gi|192359952|ref|YP_001981573.1| 498211.CJA_1077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]