SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 498213.CLD_0211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498213.CLD_0211
Domain Number 1 Region: 86-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000549
Family NfeD domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 498213.CLD_0211
Sequence length 146
Comment (Clostridium botulinum B1 Okra)
Sequence
MWSNFDIIVWIIIGTAALLLDLATSSFLFVWFTLGAIAALIVQILGYSMYIQIIVFTLIS
ILCMILGYPMVKKIIKKQENSILSIERNYVGEIFIADKDIKDEGVLKFQGVYWRVTNSGN
HIKKGDKVKINSVKGNKIFVKKVEEE
Download sequence
Identical sequences A0A2I4NVS9 B1IF50
WP_004451276.1.21789 WP_004451276.1.53136 WP_004451276.1.68124 WP_004451276.1.78559 498213.CLD_0211 gi|170755565|ref|YP_001780185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]