SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 498213.CLD_3375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498213.CLD_3375
Domain Number 1 Region: 787-1170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.51e-135
Family PFOR PP module 0.00000000332
Further Details:      
 
Domain Number 2 Region: 415-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-89
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000429
Further Details:      
 
Domain Number 3 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.65e-79
Family PFOR Pyr module 0.0000000147
Further Details:      
 
Domain Number 4 Region: 259-414
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.29e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000822
Further Details:      
 
Domain Number 5 Region: 665-832
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.26e-21
Family Ferredoxin domains from multidomain proteins 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 498213.CLD_3375
Sequence length 1172
Comment (Clostridium botulinum B1 Okra)
Sequence
MAKIMKTMDGNQAAAEASYAFTEVAAIYPITPSTPMAEGVDEWSAHGKKNIFGQSVKVVE
MQSEAGASGTVHGSLAAGALTTTYTASQGLLLMIPNLYKIAGELLPGVFHVSARALATHA
LSIFGDHQDVMATRQTGVALLAASNVQEVMDLANIAHLSAIKSRVPFLHFFDGFRTSHEY
QKIETINYDDVAKLVDYDALKEFKSRALNPEHPTLKGTAQNPDIYFQGREASNKFYEEVP
NIVENYMREIEKISGRSYHPFDYYGAPDAENVIVAMGSICDTIEETVDYLINKGQKVGVI
KIHLYRPFCPTYFMKACPKTVKKIAVLDRTKEPGSIGEPIYLDVCKVFYNTKDKPIIVGG
RYGLGSKDTRPSQIISVFDNLNQDNPKDGFTIGITDDVTNTSLPEKDVVDTTPEGTISCK
FWGLGSDGTVGANKTAVKIIGDNTDLYAQAYFSYDSKKSGGSTISHLRFGKDKIKSPYLI
YNADYIACHNKSFIYNFDVLKGLKKNGTFVLNCPWDEAELEEKLPASMKKYIAENNINFY
IIDGISIAQNIGLGGRINMIMQSAFFKLANVIPVNEAVELLKNSVEKTYGKKGEKIVEMN
KAAIDTGIDAVHKVNIPSSWKNAEVEPTSIKEEPDFIKKVQRPMSRHEGDELPVSAFNGM
EDGTFPLGTTSYEKRGIAVMIPEWQIDKCIQCNQCSYICPHSVIRAYLLNKDEKEKSPSA
FETKKATGKGLEELGYRIQISPLDCTGCGNCADVCPAPGKALIMKNAEEQIEMQSENWEF
GLNITTKENLMDPKTLKGSQFIRPLLEFHGACPGCGETPYIKLLTQLFGDRMMIANATGC
SSIWGGSAPSIPYTTNSQGKGPSWGNSLFEDNAEYGYGMYLAVKQIREKLAELMQEALNM
EINQDLKNAFKQWLESMDDGEHSKTATAKILETMPNENYQNNPILNEIMEKKDYLIKKSH
WMIGGDGWAYDIGFGGLDHVLASGDDVNIFVMDTEIYSNTGGQCSKSTQTGAIAKFAAAG
KKIKKKDLGLMAMSYGYVYVAQIAMGANMNHTIKTIAEAEAYKGPSLIIAYAPCISHGIK
TGMGTSIAEEKKAVESGYWHLYRYNPMLKEEGKNPFTLDSREPTKSFKEFIQGEVRYSSL
MNIFPGIAEKMSDMAEQHARERYDNYKHLADK
Download sequence
Identical sequences B1IJ75
gi|170755927|ref|YP_001780817.1| WP_003404323.1.21789 WP_003404323.1.53136 498213.CLD_3375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]