SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 498214.CLK_0790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498214.CLK_0790
Domain Number 1 Region: 127-283
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.92e-24
Family Rob transcription factor, C-terminal domain 0.029
Further Details:      
 
Domain Number 2 Region: 57-108
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000538
Family AraC type transcriptional activator 0.0054
Further Details:      
 
Domain Number 3 Region: 5-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000188
Family AraC type transcriptional activator 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 498214.CLK_0790
Sequence length 283
Comment (Clostridium botulinum A3 Loch Maree)
Sequence
MEMLEKLNESIQYIESNLNGEIQYEKAAQIACCSVYHYQRMFSYIAGIPLSEYIRNRRLT
KAAFDLQAGDKVVDVALRYGYESPTAFNRAFRKMHYVSPSVAKKEGTFLKACPPISFKIT
IKGVGEMKYSIIKNEEIRIVGVKAPLTKNIDENFKFVPKLWEKSAEDGSINNIVSIMNED
SKGMLGVSVCMDSLDNWEYYIAAKTDKDVPKGMHEYIIPAGTWAVFPGEGPMPKSIQEIE
KRIITEWFPTSGYEYADAPDIELYLNQDPTNAKFEVWIPIRKK
Download sequence
Identical sequences B1L0H2
498214.CLK_0790 gi|170759041|ref|YP_001786737.1| WP_012342541.1.9908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]