SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 498214.CLK_3748 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498214.CLK_3748
Domain Number 1 Region: 86-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000262
Family NfeD domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 498214.CLK_3748
Sequence length 146
Comment (Clostridium botulinum A3 Loch Maree)
Sequence
MWSNFDIIVWVIIGTATLLLDLATSSFLFVWFTLGAIAALIVQILGYSMYIQIIVFTLIS
ILCMILGYPMVKKIIKKQENSILSIERNYVGEVFRADKDIEDEGVLKFQGVYWRVINSGN
YIKKGDNVKIISVKGNKILIKKVEEE
Download sequence
Identical sequences B1KVL5
WP_012342332.1.9908 498214.CLK_3748 gi|170758800|ref|YP_001785885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]