SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 498761.HM1_1467 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498761.HM1_1467
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.48e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 498761.HM1_1467
Sequence length 197
Comment (Heliobacterium modesticaldum Ice1)
Sequence
MKKSMNILLVGVGGQGTILASKILSHVALAQGWDVKMSEIHGMAQRGGSVVTQVRLGEKV
YSPIIEPGEADIIVGFEKLEAYRWTHMLRPGGTMIVNDQKIEPLPVLIGAAAYPEGIIEA
IGERVSRLIVVPALDLAAKLGNPKAANVVLMGVLASVMDISRETWDAALAARVPARFLEL
NQRAFAAGLDHRERKEA
Download sequence
Identical sequences B0TCL4
gi|167629552|ref|YP_001680051.1| WP_012282555.1.33279 498761.HM1_1467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]