SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 500485.B6HJG8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6HJG8
Domain Number 1 Region: 200-292
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 4.58e-31
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0002
Further Details:      
 
Domain Number 2 Region: 278-386
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.75e-24
Family UBX domain 0.0011
Further Details:      
 
Domain Number 3 Region: 6-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000112
Family TAP-C domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 500485.B6HJG8
Sequence length 400
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MEGNPAEHDEAVSQFCAMTGTQASDAQEYLAANGWDIETAVTEFFAEQDEALQDTSAGGE
RQLGTEGGSGAPVGGRTLGGSAVPASSAAESSSSARRAAPKKKFATLGDFASGGGGGGGD
SSDGDDTDDHDFFAGGEKSGLAVQNPDDLKKKILEKAHKAQPPPSDAPQPRASHFTGTAR
TLGGDDAPSQVIESPSAPSQQRARRVQRTLHFWADGFSVDDGELFRSDDPRNAEILDGIR
QGRAPLSIMNVQPGQEVDVELKQHEEKYTKPKPKYKPFSGSGQRLGSPTPGVRSPAPPTP
SSSTSGTPAQEPAKPNVDESQPMVTLQIRLGDGTRLTSRFNTTATIGDVYAFVAAATPDG
ANRAWVLMTTFPSTELKDWDVVLGDMPDFKRGGVIVQKWQ
Download sequence
Identical sequences A0A167UCH8 B6HJG8
Pchr_Wisconsin_54-1255:Pc21g15270.t1 XP_002568537.1.37043 500485.B6HJG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]