SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 500485.B6HKF7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6HKF7
Domain Number 1 Region: 63-104
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000000222
Family Zn2/Cys6 DNA-binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000152
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 500485.B6HKF7
Sequence length 410
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MTPFQCHVPGCGLSYRRKEHLTRHANSHFQTKCFECSFCDRVFARNDTLRQHVRTQHKTR
ELQYSRAIQACTYCRLRRSRCDGQSPCGVCFQRGIECSYTQNSRSQALVQSRSRNPRTSP
IPSVEQDYPYSPCRAAPFIQAYFDKFHPKWPFLHPATFDPDNEPPFLVQSVVMMGSWAMM
EINTQQTAKDLHKRLTSSIYEQRGKWAVSNHHAKPHSQHHEISSSGPAPWPMATYQGILL
HLIFSLLQNHDPSDLQLTQVLPEIPSQLLVSLVHSCLKRRMFFYPSILAQFKQGIDPDVF
VWLGIEEVKRFNLSLYRVCRHAQVYDTRLLEAAPSSSPRRGPRSPGGSLLSLTDLQFAVP
DSDELWHATSDLAVKIAGSEAAYANDNIEDKWISQTARVLQPHDQQFQWI
Download sequence
Identical sequences B6HKF7
Pchr_Wisconsin_54-1255:Pc21g07310.t1 500485.B6HKF7 XP_002567772.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]