SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 502800.YPK_1913 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  502800.YPK_1913
Domain Number 1 Region: 794-1164
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.42e-117
Family PFOR PP module 0.0000000411
Further Details:      
 
Domain Number 2 Region: 417-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.62e-73
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000001
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.71e-73
Family PFOR Pyr module 0.000000093
Further Details:      
 
Domain Number 4 Region: 255-410
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.14e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000189
Further Details:      
 
Domain Number 5 Region: 665-837
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.49e-22
Family Ferredoxin domains from multidomain proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 502800.YPK_1913
Sequence length 1177
Comment (Yersinia pseudotuberculosis YPIII)
Sequence
MIMTDGNSAVASVAYRASEVIAIYPITPSSTMAEQADAWSGDGKVNIWGDVPRVVEMQSE
GGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTIATHALSIF
GDHSDVMAVRQTGCAMLCASSVQEAQDFALISQIATLNSRIPFIHFFDGFRTSHEINKIE
PLSDETLRQLLPQAGINAHRSRALSPDHPVVRGTSANPDTYFQSREATNPWYNNTYQHVA
DAMQAFAEATGREYKPFEYYGHPQADRVIILMGSAIGTCEEVIDTLLTRGEKVGVLKVRL
FRPFSAQHLLALLPASVGKIAVLDRTKEPGALAEPLYLDVMTALAEAYSRGDRDTLPKVI
GGRYGLSSKEFGPHCVLAIFRELSLDLPRPRFTVGIFDDVTGLSLPLSDEKIESRATLEA
LFYGLGSDGSVSATKNNIKIIGNSTALYAQGYFVYDSKKAGGLTVSHLRVSQTPINSAYL
VSHADFVGCHQLQFIDIYQMAERLKPGGIFLLNTPFSADEMWPRLPQDVQAVLHQRHARL
FVINAAKIARECKLGARINTVMQMAFFHLTQILPTAMAQEQLRAAIERSYSNKGAEIVTR
NWQALDATLEALIEIPLQPIDENSPVRPPIVSDQAPDFVKTVTATMLAGLGDTLPVSAFP
PDGTWPVGTTQWEKRNIAENIPIWQPDLCTQCNHCVAACPHSAIRAKVVQPEAMAGAPDS
LQSLDVKARDMRGQKYVLQVAPEDCTGCNLCYEVCPAKDRQNPEIKAINMRPHLEHRAVE
KAHYDFFLKLPEIDKTQMERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLYGDRLL
IANATGCSSIYGGNLPTTPYTTNADGRGPAWANSLFEDNAEFGLGFRLTVDQHQKRVTRL
IQQLAPQLPDELVNQLINQEYTPEERRKQVSQLRQLLREIPGNDAQQLAADADYLVDKSI
WLIGGDGWAYDIGFGGLDHVLSLTENVNVLVLDTQCYSNTGGQQSKATPLGAVTKFGEHG
KRKARKDLGVSMMMYGHVYVAQISIGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYD
LAYSHDQMKQLTATGFWPLYRFDPRRADEGKTALALDSRPPSSDLTTTLLNEQRFRRLNT
QEPAVAAQLYAEAEKDLKKRYDFLSLLAGKTEKTPSE
Download sequence
Identical sequences A0A0H3B1C7
502800.YPK_1913 gi|170024152|ref|YP_001720657.1| WP_012304037.1.52792 WP_012304037.1.99882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]