SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 502801.YPTS_1072 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  502801.YPTS_1072
Domain Number 1 Region: 90-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000288
Family NfeD domain-like 0.0092
Further Details:      
 
Weak hits

Sequence:  502801.YPTS_1072
Domain Number - Region: 28-103
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00876
Family LacY-like proton/sugar symporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 502801.YPTS_1072
Sequence length 149
Comment (Yersinia pseudotuberculosis PB1 )
Sequence
MLEEIAVNPNWFWLSLGGLLLAAEMLGASGYLLWSGIATVLVGVLVWLFPFSWEMQGVLF
SILTVVSAFLWWYWLSKRTKPQPAMLNQRNHQLLGIRATLTEPTVDGYGRMKVGDSSWRI
YCATELNPGTEVEVILVEGNTLHVRAVNR
Download sequence
Identical sequences 502801.YPTS_1072 WP_012413531.1.33324 WP_012413531.1.75208 gi|186894396|ref|YP_001871508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]